DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema2a

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_477507.1 Gene:Sema2a / 36846 FlyBaseID:FBgn0011260 Length:724 Species:Drosophila melanogaster


Alignment Length:514 Identity:185/514 - (35%)
Similarity:276/514 - (53%) Gaps:64/514 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YFKILDHND--EFVLVGAKDVIYNVSLNGL------KEIARLEWHSTDADRELCALKGKHE-WDC 115
            |::....|:  :.:.|||.|.::.|:|..:      :::..||  .|..|...|..|||.: :||
  Fly    67 YYRTFHMNEDRDTLYVGAMDRVFRVNLQNISSSNCNRDVINLE--PTRDDVVSCVSKGKSQIFDC 129

  Fly   116 HNYLRVYALRPNGEVL-LCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGL-- 177
            .|::||......|:.| :||||::.|:           :....|...|..|.|.   |...||  
  Fly   130 KNHVRVIQSMDQGDRLYVCGTNAHNPK-----------DYVIYANLTHLPRSEY---VIGVGLGI 180

  Fly   178 --CPYSPAHNSTYAFADG-------HLYSATVADFSGGDPLIYRENL-------------RTEQY 220
              |||.|..|||..:.:.       .|||.|.|:|:..|.:|:|.:|             ||.:|
  Fly   181 AKCPYDPLDNSTAIYVENGNPGGLPGLYSGTNAEFTKADTVIFRTDLYNTSAKRLEYKFKRTLKY 245

  Fly   221 DLKQLNQPDFVGAIERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLK 285
            |.|.|::|:|||:.:...||.|||||.::|.:|.|||||||:|||||.|.||......:|.::||
  Fly   246 DSKWLDKPNFVGSFDIGEYVYFFFRETAVEYINCGKAVYSRIARVCKKDVGGKNLLAHNWATYLK 310

  Fly   286 ARLNCSVPGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEF 350
            ||||||:.|||||||:|||::..:  ...||..:|.||||.|.:.|||||:|::::|.|||:|:|
  Fly   311 ARLNCSISGEFPFYFNEIQSVYQL--PSDKSRFFATFTTSTNGLIGSAVCSFHINEIQAAFNGKF 373

  Fly   351 KSQKDSQSHWLPVEREQVPKPRPGQCVEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNL 415
            |.|..|.|.||||...:||:||||.||.|:..|....:|||::||||::||...|..|:..|.:|
  Fly   374 KEQSSSNSAWLPVLNSRVPEPRPGTCVNDTSNLPDTVLNFIRSHPLMDKAVNHEHNNPVYYKRDL 438

  Fly   416 HHRLTAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLG 480
              ..|.:.|......:....|.|.|.||:.|::.|.:.....  ..::.:|..:    .:|.| .
  Fly   439 --VFTKLVVDKIRIDILNQEYIVYYVGTNLGRIYKIVQYYRN--GESLSKLLDI----FEVAP-N 494

  Fly   481 TPIRELVISTSKNSLVVVSDGSLVSVPLHHCSHIVD-CLGCLSLQDPICAWDLQTHECK 538
            ..|:.:.||.::.||.:.:|..:..:.|..|:...| |..|  ::||.|.||.:.:.|:
  Fly   495 EAIQVMEISQTRKSLYIGTDHRIKQIDLAMCNRRYDNCFRC--VRDPYCGWDKEANTCR 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 175/484 (36%)
PSI 510..>537 CDD:214655 9/27 (33%)
Sema2aNP_477507.1 Sema_2A 66..523 CDD:200499 174/482 (36%)
Ig_Semaphorin_C 573..664 CDD:143180
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.