DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema7a

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001101623.1 Gene:Sema7a / 315711 RGDID:1305192 Length:666 Species:Rattus norvegicus


Alignment Length:643 Identity:157/643 - (24%)
Similarity:257/643 - (39%) Gaps:157/643 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KSRPSSAAMLVNAIP---------MILLI-----------TLSGLTIVAGWMPDVKPDL-QTKQD 47
            ::.||:....|.::|         .:||:           :.||..|.|.|......|. |.:..
  Rat     8 RAAPSAPRARVLSLPARFGLPLRLRLLLVFWVTAASAQGHSRSGPRISAVWKGQDHVDFGQPEPH 72

  Fly    48 KVLAHFIGNSTDYFKILDHNDEFVLVGAKDVIY--------NVSLNGLKEIARLEWHSTDADREL 104
            .||.|..|:.:            |.||.:..:|        |.|:..:               .:
  Rat    73 NVLFHEPGSFS------------VWVGGRGKVYLFNFPEGKNASVRTV---------------NI 110

  Fly   105 CALKG--KHEWDCHNYLRVYALRPNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYE 167
            .:.||  :.:.||.||:.:...|.|| :|:||||:.||.|.:.    |:.....|.|        
  Rat   111 GSTKGSCQDKQDCENYITLLERRGNG-LLVCGTNARKPSCWNL----VNDSVVMSLG-------- 162

  Fly   168 VSRDVEAQGLCPYSPAHNSTYAFADGHLYSATV--ADFSGGDPLIYRENLRTEQYDLKQLNQ-PD 229
                 |.:|..|:||..||...|....:|| |:  .:::|..|...|....:|.|....:.| |.
  Rat   163 -----EMKGYAPFSPDENSLVLFEGDEVYS-TIRKQEYNGKIPRFRRIRGESELYTSDTVMQNPQ 221

  Fly   230 FVGAI---ERNGY---VLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKS-WTSFLKAR 287
            |:.|.   :...|   :.:||||.:.:.........||||::|:.|:||..|...| |.:||||.
  Rat   222 FIKATIVHQDQAYDDKIYYFFREDNPDKNPEAPLNVSRVAQLCRGDQGGESSLSVSKWNTFLKAM 286

  Fly   288 LNCSVPGEFPFYFDEIQAISPIVESGSK---SLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGE 349
            |.|| .......|:.:|.:..:.:...:   :.:|.||:...|.   ||||.:::.||    |..
  Rat   287 LVCS-DAATNRNFNRLQDVFLLPDPSGQWRDTRVYGVFSNPWNY---SAVCVYSLGDI----DRV 343

  Fly   350 FKSQKDSQSHWLPVEREQVPKPRPGQCVEDSRTLTSIAVNFIKNHPLMEEAV--------PAVHG 406
            |::......|.      .:|.||||.|:...:.:.:.......:||.:.:.|        |..|.
  Rat   344 FRTSSLKGYHM------GLPNPRPGMCLPKKQPIPTETFQVADSHPEVAQRVEPMGPLKTPLFHS 402

  Fly   407 RPLLTKVNLHHRLTAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVI 471
            :....||.:|          ::::.:|..:.|:|..||.|.:.|.:        .:.|:..:.|.
  Rat   403 KYHYQKVVVH----------RMQASNGETFHVLYLTTDRGTIHKVV--------ESGDQEHSFVF 449

  Fly   472 SEMQVLPL--GTPIRELVISTSKNSLVVVSDGSLVSVPLHHCS-HIVDCLGCLSLQDPICAWDLQ 533
            :.|::.|.  ...|:.:.:...:..|.|.|...:..|||..|. :...|.|||..:||.|.||..
  Rat   450 NIMEIQPFHRAAAIQAISLDADRRKLYVTSPWEVSQVPLDMCGVYSGGCHGCLMSRDPYCGWDQD 514

  Fly   534 THECKNLATSQHKFGTKTYLQSLNSTKKAAALLCPHIPRDAPGAETVSFVTMAPPPTE 591
            ...|.::.:||     ::.|||:|..:       ||  |:.|.          |.|.|
  Rat   515 QDRCVSIYSSQ-----RSVLQSINPAE-------PH--RECPN----------PNPDE 548

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 117/488 (24%)
PSI 510..>537 CDD:214655 10/27 (37%)
Sema7aNP_001101623.1 PSI 491..>520 CDD:279745 11/28 (39%)
Ig 549..622 CDD:299845 157/643 (24%)
Sema_7A 70..489 CDD:200504 119/496 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.000

Return to query results.
Submit another query.