DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema5a

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001101129.1 Gene:Sema5a / 310207 RGDID:1308650 Length:1074 Species:Rattus norvegicus


Alignment Length:504 Identity:183/504 - (36%)
Similarity:259/504 - (51%) Gaps:54/504 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 NSTDYFKI-LDHNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEWDCHNYL 119
            |:.|:.:: .|...:.::|||::.::.:.|..|..|..::|...:|.::.|..|||.:.:|.||:
  Rat    54 NAVDFSRLTFDPGQKELVVGARNYLFRLQLEDLSLIQAVQWECDEATKKACYSKGKSKEECQNYI 118

  Fly   120 RVYALRPNGEVLL-CGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYSPA 183
            ||  |...|:.|. ||||::.|.|...:...::               |:...:.....|||||.
  Rat   119 RV--LLVGGDRLFTCGTNAFTPVCTIRSLSNLT---------------EIHDQISGMARCPYSPQ 166

  Fly   184 HNSTYAF-ADGHLYSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAIERNGYVLF 242
            ||||... |.|.||:||..||.|.||.|||.     .|||.||:.|.||:|:||.:.:...:..|
  Rat   167 HNSTALLTASGELYAATAMDFPGRDPAIYRSLGTLPPLRTAQYNSKWLNEPNFVSSYDIGNFTYF 231

  Fly   243 FFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGEFPFYFDEIQAIS 307
            ||||.::| .:.||.|:||.|||||||.||.:....:||:|:|||||||.|||.|||::|:|:..
  Rat   232 FFRENAVE-HDCGKTVFSRAARVCKNDIGGRFLLEDTWTTFMKARLNCSRPGEVPFYYNELQSTF 295

  Fly   308 PIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVPKPR 372
            .:.|   ..|||.:|||:||:|..||||.||:..|..||:|.||.|::|:|.|||     .|.|.
  Rat   296 FLPE---LDLIYGIFTTNVNSIAASAVCVFNLSAISQAFNGPFKYQENSRSAWLP-----YPNPN 352

  Fly   373 PG-QCVEDSR----TLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHPQVKSLS 432
            |. ||....:    .||...:...:...||.|.|..|...|...:.|  .|.:.:||  .|....
  Rat   353 PNFQCGTMDQGLYVNLTERNLQDAQKFILMHEVVQPVTTVPSFMEDN--SRFSHVAV--DVVQGR 413

  Fly   433 GAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLP--LGTPIRELVISTSKNSL 495
            .....:||..||.|.:.|....||....|       .::.|:::.|  ...|||.|.|..|::.|
  Rat   414 DTLVHIIYLATDYGTIKKVRAPLSQSSGS-------CLLEEIELFPERKSEPIRSLKILHSQSVL 471

  Fly   496 VVVSDGSLVSVPLHHCSHIVDCLG-CLSLQDPICAWDLQTHECKNLATS 543
            .|.....:|.:||..| |.....| |:..|||.|.||....:|.:|..|
  Rat   472 FVGLQEHVVKIPLKRC-HFHQTRGACIGAQDPYCGWDAVMKKCTSLEES 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 170/469 (36%)
PSI 510..>537 CDD:214655 10/27 (37%)
Sema5aNP_001101129.1 Sema_5A 50..485 CDD:200524 169/467 (36%)
PSI 486..533 CDD:279745 13/35 (37%)
TSP1 544..595 CDD:214559
TSP1 598..651 CDD:214559
TSP1 656..702 CDD:214559
TSP1 787..839 CDD:214559
TSP1 853..896 CDD:214559
TSP1 899..940 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.