DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema3c

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_008760867.1 Gene:Sema3c / 296787 RGDID:1309343 Length:760 Species:Rattus norvegicus


Alignment Length:568 Identity:166/568 - (29%)
Similarity:282/568 - (49%) Gaps:65/568 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SAAMLVNAIPMILLITLSGLTIVAGWMPDVKPDL------QTKQDKV--LAHFIGNSTDY-FKIL 64
            |..|.:..|.:::.:.:..:.:.....|..:..|      :||..:.  |:|   ...|| ..::
  Rat     4 SEEMALREICVLVGVFICSICVQGSSQPQARVYLTFDELRETKTSEYFSLSH---QQLDYRILLM 65

  Fly    65 DHNDEFVLVGAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGK---HEWDCHNYLRVYALR 125
            |.:.:.:.||:||.|.::::|.: :|...:.|.::....|.|.:.||   |  .|.|::||....
  Rat    66 DEDQDRIYVGSKDHILSLNINNISQEPLSVFWPASTIKVEECKMAGKDPTH--GCGNFVRVIQTF 128

  Fly   126 PNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEA-QGLCPYSPAHNSTYA 189
            ....:.:||:.::.|.|.:......|.::.          :.:....|: :|.|.::|..|:...
  Rat   129 NRTHLYVCGSGAFSPVCTYLNRGRRSEDQV----------FMIDSKCESGKGRCSFNPNVNTVSV 183

  Fly   190 FADGHLYSATVADFSGGDPLIY-----RENLRTEQYDLKQLNQPDFV-------GAIERNGYVLF 242
            ..:..|:|....||.|.|..|:     |..:||:|::.|.|::|.||       |....:..|.|
  Rat   184 MINEELFSGMYIDFMGTDAAIFRSLTKRNAVRTDQHNSKWLSEPMFVDAHVIPDGTDPNDAKVYF 248

  Fly   243 FFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGEF--PFYFDEIQA 305
            ||:|...:.....|.::|.|||:|.||.||..|....||:||||||.|||..|.  ..:|||::.
  Rat   249 FFKERLTDNNRSTKQIHSMVARICPNDTGGQRSLVNKWTTFLKARLVCSVTDEDGPETHFDELED 313

  Fly   306 ISPI-VESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVP 369
            :..: .::...:|:|.:||||.:...|||||.:::.||...|:|.| :.|:..:|.|...:.::|
  Rat   314 VFLLETDNPRTTLVYGIFTTSSSVFKGSAVCVYHLSDIQTVFNGPF-AHKEGPNHQLISYQGRIP 377

  Fly   370 KPRPGQC--------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHP 426
            .||||.|        :..::......|.||:|||||..::..:|.|||:.::...::.|.||| .
  Rat   378 YPRPGTCPGGAFTPNMRTTKDFPDDVVTFIRNHPLMYNSIYPIHRRPLIVRIGTDYKYTKIAV-D 441

  Fly   427 QVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIRELVISTS 491
            :|.:..|.|: |::.|||.|.|.|.: :|.|:.:::.:    :::.|::|.....||..:.||:.
  Rat   442 RVNAADGRYH-VLFLGTDRGTVQKVV-VLPTNSSASGE----LILEELEVFKNHVPITTMKISSK 500

  Fly   492 KNSLVVVSDGSLVSVPLHHCSHI--VDCLGCLSLQDPICAWDLQTHEC 537
            |..|.|.|:..:..|.||.| ||  ..|..|...:||.||||  .|.|
  Rat   501 KQQLYVSSNEGVSQVSLHRC-HIYGTACADCCLARDPYCAWD--GHSC 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 144/484 (30%)
PSI 510..>537 CDD:214655 12/28 (43%)
Sema3cXP_008760867.1 Sema_3C 51..520 CDD:200512 146/491 (30%)
PSI 519..556 CDD:214655 13/30 (43%)
Ig_Semaphorin_classIII 584..673 CDD:143279
IG_like 588..662 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.