DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema3d

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001098103.1 Gene:Sema3d / 246262 RGDID:727939 Length:777 Species:Rattus norvegicus


Alignment Length:583 Identity:184/583 - (31%)
Similarity:294/583 - (50%) Gaps:65/583 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPSSAAMLVNAIPMILLITLSGLTIVAGWMPDVKPDLQ-TKQDKVLAH----FIGNS--TDY-FK 62
            ||.|..:.:....|:|::|:..|.:......:: |.|: |.:|.:|::    |:|:|  .|: ..
  Rat    10 RPRSQDLHLFHAGMMLIVTVLYLPVTETSKQNI-PRLKLTYKDLLLSNTCIPFLGSSEGLDFQTL 73

  Fly    63 ILDHNDEFVLVGAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGKH-EWDCHNYLRVYALR 125
            :||.....:|:||||.::.::|..| |...::.|.:.....|||.|.||. ..:|.|::||  |:
  Rat    74 LLDEERGILLLGAKDHVFLLNLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRV--LQ 136

  Fly   126 PNGE--VLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVS-RDVEAQGL-CPYSPAHNS 186
            |..:  |.:|||.::.|.| .|..:..:.||         :.:::. :::|:..| ||:.|....
  Rat   137 PYNKTHVYVCGTGAFHPLC-GYIDLGANKEE---------LIFKLDMQNLESGRLKCPFDPQQPF 191

  Fly   187 TYAFADGHLYSATVADFSGGDPLIYR--------ENLRTEQYDLKQLNQPDFVGAI-------ER 236
            .....|.||||.|.:||.|.|....|        ..:||:..:...||...|:|..       ..
  Rat   192 ASVMTDEHLYSGTASDFLGKDTAFTRSLGLMQDHHYIRTDISEHYWLNGAKFIGTFPIPDTYNPD 256

  Fly   237 NGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE--FPFY 299
            :..:.|||||.|.|.....:::.|||.||||||.||..|....||:||||||.||:||.  ...:
  Rat   257 DDKIYFFFRESSQEGSTSDRSILSRVGRVCKNDVGGQRSLINKWTTFLKARLVCSIPGSDGADTH 321

  Fly   300 FDEIQAISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPV 363
            |||:|.|..:.....:: ::|.||||:.:...|||||.:::.||.|.|:|.:..::.:...|:..
  Rat   322 FDELQDIYLLPTRDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQY 386

  Fly   364 EREQVPKPRPGQC--------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLT 420
            : .::|.||||.|        ::.:|......::||:.||:|.::|..|.|.|...::|:.:|||
  Rat   387 D-GRIPYPRPGTCPSKTYDPLIKSTRDFPDDVISFIRRHPVMYKSVYPVAGAPTFKRINVDYRLT 450

  Fly   421 AIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIRE 485
            .|.|...|  .....|||::.|||.|.|.|.::|.....|     ::.||:.|:||....|.|..
  Rat   451 QIVVDHVV--AEDGQYDVMFLGTDIGTVLKVVSISKEKWN-----MEEVVLEELQVFKHPTAILN 508

  Fly   486 LVISTSKNSLVVVSDGSLVSVPLHHC-SHIVDCLGCLSLQDPICAWDLQTHECKNLA-TSQHK 546
            :.:|..:..|.|.|...||.:.||.| ::...|..|...:||.||||  .:.|...| ||:.:
  Rat   509 MELSLKQQQLYVGSWDGLVQLSLHRCDTYGKACADCCLARDPYCAWD--GNACSRYAPTSKRR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 158/490 (32%)
PSI 510..>537 CDD:214655 9/27 (33%)
Sema3dNP_001098103.1 Sema_3D 61..534 CDD:200513 159/492 (32%)
PSI 533..570 CDD:214655 13/39 (33%)
Ig_Sema3 595..686 CDD:409455
Ig strand B 609..613 CDD:409455
Ig strand C 621..625 CDD:409455
Ig strand E 648..652 CDD:409455
Ig strand F 662..667 CDD:409455
Ig strand G 679..682 CDD:409455
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.