DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and SEMA3D

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001371829.1 Gene:SEMA3D / 223117 HGNCID:10726 Length:777 Species:Homo sapiens


Alignment Length:571 Identity:180/571 - (31%)
Similarity:285/571 - (49%) Gaps:63/571 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PMILLITLSGLTI-VAGWMPDVKPDLQ-TKQDKVLAH----FIGNS--TDY-FKILDHNDEFVLV 73
            |.:::::::.|.: |.|.:....|.|: |.:|.:|::    |:|:|  .|: ..:||.....:|:
Human    20 PALMMLSMTMLFLPVTGTLKQNIPRLKLTYKDLLLSNSCIPFLGSSEGLDFQTLLLDEERGRLLL 84

  Fly    74 GAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGKH-EWDCHNYLRVYALRPNGE--VLLCG 134
            ||||.|:.:||..| |...::.|.:.....|||.|.||. ..:|.|::||  |:|..:  :.:||
Human    85 GAKDHIFLLSLVDLNKNFKKIYWPAAKERVELCKLAGKDANTECANFIRV--LQPYNKTHIYVCG 147

  Fly   135 TNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGL-CPYSPAHNSTYAFADGHLYSA 198
            |.::.|.| .|..:.|..|:.......|        ::|:..| ||:.|.........|.:|||.
Human   148 TGAFHPIC-GYIDLGVYKEDIIFKLDTH--------NLESGRLKCPFDPQQPFASVMTDEYLYSG 203

  Fly   199 TVADFSGGDPLIYR--------ENLRTEQYDLKQLNQPDFVGAI-------ERNGYVLFFFRELS 248
            |.:||.|.|....|        ..:||:..:...||...|:|..       ..:..:.|||||.|
Human   204 TASDFLGKDTAFTRSLGPTHDHHYIRTDISEHYWLNGAKFIGTFFIPDTYNPDDDKIYFFFRESS 268

  Fly   249 MEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE--FPFYFDEIQAISPIVE 311
            .|.....|.:.|||.||||||.||..|....||:||||||.||:||.  ...||||:|.|..:..
Human   269 QEGSTSDKTILSRVGRVCKNDVGGQRSLINKWTTFLKARLICSIPGSDGADTYFDELQDIYLLPT 333

  Fly   312 SGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVPKPRPGQ 375
            ...:: ::|.||||:.:...|||||.:::.||.|.|:|.:..::.:...|:..: .::|.||||.
Human   334 RDERNPVVYGVFTTTSSIFKGSAVCVYSMADIRAVFNGPYAHKESADHRWVQYD-GRIPYPRPGT 397

  Fly   376 C--------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHPQVKSLS 432
            |        ::.:|......::|||.|.:|.::|..|.|.|...::|:.:|||.|.|...:  ..
Human   398 CPSKTYDPLIKSTRDFPDDVISFIKRHSVMYKSVYPVAGGPTFKRINVDYRLTQIVVDHVI--AE 460

  Fly   433 GAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIRELVISTSKNSLVV 497
            ...|||::.|||.|.|.|.::|.....|     ::.||:.|:|:....:.|..:.:|..:..|.:
Human   461 DGQYDVMFLGTDIGTVLKVVSISKEKWN-----MEEVVLEELQIFKHSSIILNMELSLKQQQLYI 520

  Fly   498 VSDGSLVSVPLHHC-SHIVDCLGCLSLQDPICAWDLQTHECKNLA-TSQHK 546
            .|...||.:.||.| ::...|..|...:||.||||  .:.|...| ||:.:
Human   521 GSRDGLVQLSLHRCDTYGKACADCCLARDPYCAWD--GNACSRYAPTSKRR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 157/489 (32%)
PSI 510..>537 CDD:214655 9/27 (33%)
SEMA3DNP_001371829.1 Sema_3D 61..534 CDD:200513 158/491 (32%)
PSI 533..570 CDD:214655 13/39 (33%)
Ig_Sema3 595..686 CDD:409455
Ig strand B 609..613 CDD:409455
Ig strand C 621..625 CDD:409455
Ig strand E 648..652 CDD:409455
Ig strand F 662..667 CDD:409455
Ig strand G 679..682 CDD:409455
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 738..777
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.