DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema3b

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001036244.1 Gene:Sema3b / 20347 MGIID:107561 Length:749 Species:Mus musculus


Alignment Length:561 Identity:177/561 - (31%)
Similarity:279/561 - (49%) Gaps:61/561 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 RPSSAAMLVNAIPMILLITLSGLTIVAGWMPDVKPDLQTKQDK--VLAHFIGNSTDYFKIL-DHN 67
            |..:|||    ||.:.|:.::||...|..:|.::...|..|.:  |....:..:..|..:| |..
Mouse     3 RAEAAAM----IPGLALLWVAGLGDTAPNLPRLRLSFQELQARHGVRTFRLERTCCYEALLVDEE 63

  Fly    68 DEFVLVGAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGKH-EWDCHNYLRVYALRPNGEV 130
            ...:.|||::.:.::||:.: |...:|.|.:....||.|...||. ..:|.|::::.....:..:
Mouse    64 RGRLFVGAENHVASLSLDNISKRAKKLAWPAPVEWREECNWAGKDIGTECMNFVKLLHTYNHTHL 128

  Fly   131 LLCGTNSYKPRCRHYTPVEVSSEEAGSAGH---AHAMRYEVSRDVEAQGLCPYSPAHNSTYAFAD 192
            |.|||.::.|.|..   |||        ||   ...::.:..:..:.:|..||.|.|.:......
Mouse   129 LACGTGAFHPTCAF---VEV--------GHRLEEPMLQLDRRKLEDGKGKTPYDPRHRAASVLVG 182

  Fly   193 GHLYSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAI-------ERNGYVLFFFR 245
            ..|||...||..|.|..|:|.     :||||.:|.:.||:|.||...       ..:..:.||||
Mouse   183 EELYSGVTADLMGRDFTIFRSLGQNPSLRTEPHDSRWLNEPKFVKVFWIPESENPDDDKIYFFFR 247

  Fly   246 ELSMEVM-NFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPG-EFPFYFDEIQAISP 308
            |.::|.. ..|:...|||.::|:||.||..|....||:||||||.||||| |...:||::|.:. 
Mouse   248 ESAVEAAPAMGRMSVSRVGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGVEGDTHFDQLQDVF- 311

  Fly   309 IVESGSKS--LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWLPVEREQVPKP 371
            ::.|..:.  |:||||:||.....|||||.::::|:..||.|.|..::.....|:..: .:||.|
Mouse   312 LLSSRDRQTPLLYAVFSTSSGVFQGSAVCVYSMNDVRRAFLGPFAHKEGPTHQWVSYQ-GRVPYP 375

  Fly   372 RPGQCVEDSRTLTSIA---------VNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRLTAIAVHPQ 427
            |||.|  .|:|..:.:         :.|.:|||||...|..:.||||..:|...:..|.||. .:
Mouse   376 RPGMC--PSKTFGTFSSTKDFPDDVIQFARNHPLMYNPVLPMGGRPLFLQVGAGYTFTQIAA-DR 437

  Fly   428 VKSLSGAYYDVIYSGTDDGKVTKFINI-LSTHPNSTVDRLKTVVISEMQVLPLGTPIRELVISTS 491
            |.:..| :|||::.|||.|.|.|.|:: ..:.|||     :.:::.|:||......|..:.||:.
Mouse   438 VAAADG-HYDVLFIGTDVGTVLKVISVPKGSRPNS-----EGLLLEELQVFEDSAAITSMQISSK 496

  Fly   492 KNSLVVVSDGSLVSVPLHHCSHI-VDCLGCLSLQDPICAWD 531
            :..|.:.|..::..:.||.|:.: ..|..|...:||.||||
Mouse   497 RQQLYIASRSAVAQIALHRCTALGRACAECCLARDPYCAWD 537

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 154/487 (32%)
PSI 510..>537 CDD:214655 9/23 (39%)
Sema3bNP_001036244.1 Sema 46..516 CDD:417757 154/491 (31%)
PSI 515..>551 CDD:214655 9/23 (39%)
Ig 575..665 CDD:416386
Ig strand A 575..580 CDD:409353
Ig strand B 585..593 CDD:409353
Ig strand C 599..605 CDD:409353
Ig strand C' 607..610 CDD:409353
Ig strand D 620..624 CDD:409353
Ig strand E 627..634 CDD:409353
Ig strand F 640..649 CDD:409353
Ig strand G 652..665 CDD:409353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.