DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and Sema3a

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001230001.1 Gene:Sema3a / 20346 MGIID:107558 Length:772 Species:Mus musculus


Alignment Length:684 Identity:196/684 - (28%)
Similarity:303/684 - (44%) Gaps:113/684 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IGNSTDYFK-ILDHNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEW-DCH 116
            :.||:.|.. :||.....:.|||||.|::.:|..:|:..::.|..:...|:.|...||... :|.
Mouse    51 LANSSSYHTFLLDEERSRLYVGAKDHIFSFNLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECA 115

  Fly   117 NYLRVYALRPNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYS 181
            |:::|........:..|||.::.|.|.:.        |.|.....:..:.:.|.....:|..||.
Mouse   116 NFIKVLEAYNQTHLYACGTGAFHPICTYI--------EVGHHPEDNIFKLQDSHFENGRGKSPYD 172

  Fly   182 PAHNSTYAFADGHLYSATVADFSGGDPLIYR-----ENLRTEQYDLKQLNQPDFVGA-------I 234
            |...:.....||.|||.|.|||.|.|..|:|     ..:||||:|.:.||.|.|:.|       .
Mouse   173 PKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPRFISAHLIPESDN 237

  Fly   235 ERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE--FP 297
            ..:..|.|||||.:::..:.|||.::|:.::||||.||..|....||:||||||.|||||.  ..
Mouse   238 PEDDKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGID 302

  Fly   298 FYFDEIQAISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWL 361
            .:|||:|.:..:.....|: ::|.|||||.|...|||||.:::.|:...|.|.:..:......|:
Mouse   303 THFDELQDVFLMNSKDPKNPIVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWV 367

  Fly   362 PVEREQVPKPRPGQC-------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRL 419
            |.: .:||.||||.|       .:.::.|....:.|.::||.|...|..::.||::.|.:::::.
Mouse   368 PYQ-GRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPINNRPIMIKTDVNYQF 431

  Fly   420 TAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIR 484
            |.|.| .:|.:..| .|||::.|||.|.|.|.:::    |..|...|:.|::.||.|....|.|.
Mouse   432 TQIVV-DRVDAEDG-QYDVMFIGTDVGTVLKVVSV----PKETWHDLEEVLLEEMTVFREPTTIS 490

  Fly   485 ELVISTSKNSLVVVSDGSLVSVPLHHCS-HIVDCLGCLSLQDPICAWDLQ--------------- 533
            .:.:||.:..|.:.|...:..:|||.|. :...|..|...:||.||||..               
Mouse   491 AMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGSSCSRYFPTAKRRTRR 555

  Fly   534 ---------THECKNLATSQHKFG-------------TKTYL---------------QSLNSTKK 561
                     || |.:|....:..|             :.|:|               |..|..:|
Mouse   556 QDIRNGDPLTH-CSDLQHHDNHHGPSLEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEDRK 619

  Fly   562 AAALLCPHIPRDAPGAETVSFVTMAPPPTEEQKLLYSNVGSSQGNQPSLEQQPTGGDDFGLNKIT 626
            ....:..||.|                 ||:..||.|......||.  |......|....|.|:|
Mouse   620 EEIRMGDHIIR-----------------TEQGLLLRSLQKKDSGNY--LCHAVEHGFMQTLLKVT 665

  Fly   627 LTSMDPDDIMPNLN-DPQKSTASVDEIKYASTPS 659
            |..:|.:.:...|: |.....:.:.|:..:.|||
Mouse   666 LEVIDTEHLEELLHKDDDGDGSKIKEMSSSMTPS 699

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 154/479 (32%)
PSI 510..>537 CDD:214655 11/51 (22%)
Sema3aNP_001230001.1 Sema_3A 26..518 CDD:200510 154/481 (32%)
PSI 516..>552 CDD:214655 9/35 (26%)
Ig_Sema3 580..671 CDD:409455 21/109 (19%)
Ig strand B 594..598 CDD:409455 2/3 (67%)
Ig strand C 606..610 CDD:409455 0/3 (0%)
Ig strand E 633..637 CDD:409455 0/3 (0%)
Ig strand F 647..652 CDD:409455 2/6 (33%)
Ig strand G 664..667 CDD:409455 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 729..772
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.