DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and adt-2

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001024532.2 Gene:adt-2 / 181022 WormBaseID:WBGene00000083 Length:1020 Species:Caenorhabditis elegans


Alignment Length:428 Identity:83/428 - (19%)
Similarity:126/428 - (29%) Gaps:152/428 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ITLSGLTIVAGWMPDVKPDLQ---------TKQDKVLAHFI---GNS---TDYFKILDHN----- 67
            :||.....:..:.|...|.|.         |:|...||.::   ||:   .|.|.....|     
 Worm   244 LTLLNNIQIMYYQPTASPPLTFRVIRYEVLTRQPSALAGYLHNHGNAQMYLDRFCRYQRNLAVRD 308

  Fly    68 -DEFVLVGAKDVIYNVSLNGLKEIARLE-----WHSTDADRELCALKGKHEWDCHNYLRVYALRP 126
             |..:::...|:........:..||||:     |::       |.|                   
 Worm   309 WDHAIMLTGYDIHRGAGSRSISGIARLDGMCDPWNT-------CTL------------------- 347

  Fly   127 NGEVLLCGTNSYKPRCRHYTPVEVSSEEAG-SAGHAHAMRYEVSRDVEAQGLCPYSPAHNSTYAF 190
             .|.|            .:|...:.:.|.| |.|..|...|..|:.:.:..|.| .....||.:.
 Worm   348 -AEGL------------DFTSAFIGTHELGHSVGMRHDEPYCQSKHIMSSSLGP-GKVTWSTCSL 398

  Fly   191 ADGHLYSATVADFSGGDPL-------------------IYRENLRTEQYDLKQLNQPDFVGAIER 236
            .|.|.:...: |..|.:.|                   ||..||:.|              .:..
 Worm   399 RDYHQFLQRL-DGRGKNCLRVSNMPNKLEISSNVKPGQIYDANLQCE--------------LMHG 448

  Fly   237 NGYVLFFFRELSMEVM---------NFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSV 292
            |||.....|:.|.:.:         :||:.:.|..|      ..|.:.....|     .:|...|
 Worm   449 NGYQQVTPRQDSYDGICYMMWCGQSSFGRIITSHPA------LEGTFCGPSKW-----CQLGRCV 502

  Fly   293 PGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGS------AVCA-FNVDDILAAFDGEF 350
            |      :.....|.|.|:.     :..|.||..:.|.||      .:|: ...:.||.      
 Worm   503 P------WTGTNEIQPTVQH-----VAPVVTTLPSRIDGSWSGWGATICSQCTCNGILG------ 550

  Fly   351 KSQKDSQSHWLPVEREQVPKPRPGQCVEDSRTLTSIAV 388
                   |..|.:.|.....|.|.....|....||.||
 Worm   551 -------SVGLAIARRTCSAPYPANGGSDCVGSTSRAV 581

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 74/384 (19%)
PSI 510..>537 CDD:214655
adt-2NP_001024532.2 Pep_M12B_propep 52..163 CDD:307618
ZnMc 211..417 CDD:320741 41/213 (19%)
TSP1 705..751 CDD:214559
TSP1 760..810 CDD:214559
TSP1 816..860 CDD:214559
TSP1 866..910 CDD:214559
TSP1 918..963 CDD:214559
TSP1 969..1015 CDD:214559
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.