DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and AgaP_AGAP006634

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_316666.4 Gene:AgaP_AGAP006634 / 1277221 VectorBaseID:AGAP006634 Length:718 Species:Anopheles gambiae


Alignment Length:512 Identity:186/512 - (36%)
Similarity:273/512 - (53%) Gaps:60/512 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 YFK--ILDHNDEFVLVGAKDVIYNVSLNGLK----EIARLEWHSTDADRELCALKGKHE-WDCHN 117
            |::  .||...:.:.|||.|.::.::|..:.    |...:....|.:|...|..|||.| :||.|
Mosquito    62 YYRTFYLDEERDTLYVGAMDRVFKLNLKNVSMTSCERDTIVLDPTSSDIRNCVSKGKSEMFDCKN 126

  Fly   118 YLRVYALRPNGEVL-LCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGL---- 177
            ::||.....:|..| :||||::.|:           :....:...|..|.|.   |...||    
Mosquito   127 HIRVIQPMDSGNRLYICGTNAHNPK-----------DLVIYSNLTHLPRSEY---VPGIGLGIAK 177

  Fly   178 CPYSPAHNSTYAFAD-GH------LYSATVADFSGGDPLIYRENL-------------RTEQYDL 222
            |||.|..|||..:.: |:      |||.|.|:|:..|.:|:|.:|             ||.:||.
Mosquito   178 CPYDPYDNSTAIYVEQGNPGDLPALYSGTNAEFTKADTVIFRTDLYNMTTGKKVFNFKRTLKYDS 242

  Fly   223 KQLNQPDFVGAIERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKAR 287
            |.|::|:|||:.:...:|.|||||.::|.:|.|||||||||||||.|.||.....::|.::||||
Mosquito   243 KWLDKPNFVGSFDIGEHVYFFFRETAVEYINCGKAVYSRVARVCKKDTGGKNILNQNWATYLKAR 307

  Fly   288 LNCSVPGEFPFYFDEIQAISPIVESGSKSLIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKS 352
            :|||:.|||||||:|||.:..:  ...|:..||.||||.|.:.|||||:|::::|..||.|:||.
Mosquito   308 INCSISGEFPFYFNEIQDVYQL--PTDKTKFYATFTTSTNGLVGSAVCSFDINEIHGAFAGKFKE 370

  Fly   353 QKDSQSHWLPVEREQVPKPRPGQCVEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHH 417
            |..|.|.||||...::|:||||.||.|:.||....:|||::||||::||...|..|:..|.:|  
Mosquito   371 QASSNSAWLPVLNSKIPEPRPGTCVNDTSTLPDSVLNFIRSHPLMDKAVNHEHNNPVYYKRDL-- 433

  Fly   418 RLTAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTP 482
            ..|.:.|......:....|.|.|.||:.|::.|.:..|....:.:    |.:.|.|   :.....
Mosquito   434 VFTKLVVDKIKIEILSQEYTVFYIGTNAGRIYKIVQYLRNGESKS----KLLDIFE---IAQNEA 491

  Fly   483 IRELVISTSKNSLVVVSDGSLVSVPLHHCSHIVD-CLGCLSLQDPICAWDLQTHECK 538
            |:.:.:|..:.||.|.:|..:..:.|..|:...| |..|  ::||.|.||..|..||
Mosquito   492 IQVMELSQKRKSLYVATDYRIKQIDLAMCNRRYDNCFRC--VKDPYCGWDKDTSTCK 546

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 174/482 (36%)
PSI 510..>537 CDD:214655 10/27 (37%)
AgaP_AGAP006634XP_316666.4 Sema_2A 62..518 CDD:200499 173/480 (36%)
Ig_Semaphorin_C 568..659 CDD:143180
IG_like 571..656 CDD:214653
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.