DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and SEMA3A

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_006071.1 Gene:SEMA3A / 10371 HGNCID:10723 Length:771 Species:Homo sapiens


Alignment Length:692 Identity:198/692 - (28%)
Similarity:305/692 - (44%) Gaps:130/692 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 IGNSTDYFK-ILDHNDEFVLVGAKDVIYNVSLNGLKEIARLEWHSTDADRELCALKGKHEW-DCH 116
            :.||:.|.. :||.....:.|||||.|::..|..:|:..::.|..:...|:.|...||... :|.
Human    51 LANSSSYHTFLLDEERSRLYVGAKDHIFSFDLVNIKDFQKIVWPVSYTRRDECKWAGKDILKECA 115

  Fly   117 NYLRVYALRPNGEVLLCGTNSYKPRCRHYTPVEVSSEEAGSAGHAHAMRYEVSRDVEAQGLCPYS 181
            |:::|........:..|||.::.|.|.:.        |.|.....:..:.|.|.....:|..||.
Human   116 NFIKVLKAYNQTHLYACGTGAFHPICTYI--------EIGHHPEDNIFKLENSHFENGRGKSPYD 172

  Fly   182 PAHNSTYAFADGHLYSATVADFSGGDPLIYR-----ENLRTEQYDLKQLNQPDFVGA-------I 234
            |...:.....||.|||.|.|||.|.|..|:|     ..:||||:|.:.||.|.|:.|       .
Human   173 PKLLTASLLIDGELYSGTAADFMGRDFAIFRTLGHHHPIRTEQHDSRWLNDPKFISAHLISESDN 237

  Fly   235 ERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE--FP 297
            ..:..|.|||||.:::..:.|||.::|:.::||||.||..|....||:||||||.|||||.  ..
Human   238 PEDDKVYFFFRENAIDGEHSGKATHARIGQICKNDFGGHRSLVNKWTTFLKARLICSVPGPNGID 302

  Fly   298 FYFDEIQAISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHWL 361
            .:|||:|.:..:.....|: ::|.|||||.|...|||||.:::.|:...|.|.:..:......|:
Human   303 THFDELQDVFLMNFKDPKNPVVYGVFTTSSNIFKGSAVCMYSMSDVRRVFLGPYAHRDGPNYQWV 367

  Fly   362 PVEREQVPKPRPGQC-------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHRL 419
            |.: .:||.||||.|       .:.::.|....:.|.::||.|...|..::.||::.|.:::::.
Human   368 PYQ-GRVPYPRPGTCPSKTFGGFDSTKDLPDDVITFARSHPAMYNPVFPMNNRPIVIKTDVNYQF 431

  Fly   420 TAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPIR 484
            |.|.| .:|.:..| .|||::.|||.|.|.|.::|    |..|...|:.|::.||.|....|.|.
Human   432 TQIVV-DRVDAEDG-QYDVMFIGTDVGTVLKVVSI----PKETWYDLEEVLLEEMTVFREPTAIS 490

  Fly   485 ELVISTSKNSLVVVSDGSLVSVPLHHCS-HIVDCLGCLSLQDPICAWDLQ--------------- 533
            .:.:||.:..|.:.|...:..:|||.|. :...|..|...:||.||||..               
Human   491 AMELSTKQQQLYIGSTAGVAQLPLHRCDIYGKACAECCLARDPYCAWDGSACSRYFPTAKRRTRR 555

  Fly   534 ---------THECKNLATSQHK---------FG---TKTYL---------------QSLNSTKKA 562
                     || |.:|....|.         :|   :.|:|               |..|..:|.
Human   556 QDIRNGDPLTH-CSDLHHDNHHGHSPEERIIYGVENSSTFLECSPKSQRALVYWQFQRRNEERKE 619

  Fly   563 AALLCPHIPRDAPGAETVSFVTMAPPPTEEQKLLYSNVGSSQGNQPSLEQQPTG---------GD 618
            ...:..||.|                 |::..||           .||:|:.:|         |.
Human   620 EIRVDDHIIR-----------------TDQGLLL-----------RSLQQKDSGNYLCHAVEHGF 656

  Fly   619 DFGLNKITLTSMDPDDIMPNLN-DPQKSTASVDEIKYASTPS 659
            ...|.|:||..:|.:.:...|: |.....:...|:..:.|||
Human   657 IQTLLKVTLEVIDTEHLEELLHKDDDGDGSKTKEMSNSMTPS 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 156/479 (33%)
PSI 510..>537 CDD:214655 11/51 (22%)
SEMA3ANP_006071.1 Sema_3A 26..518 CDD:200510 156/481 (32%)
PSI 516..>552 CDD:214655 9/35 (26%)
Ig_Sema3 579..670 CDD:409455 21/118 (18%)
Ig strand B 593..597 CDD:409455 2/3 (67%)
Ig strand C 605..609 CDD:409455 0/3 (0%)
Ig strand E 632..636 CDD:409455 0/3 (0%)
Ig strand F 646..651 CDD:409455 0/4 (0%)
Ig strand G 663..666 CDD:409455 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 728..771
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3611
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.