DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and dok2

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:XP_002932742.2 Gene:dok2 / 100487659 XenbaseID:XB-GENE-982227 Length:416 Species:Xenopus tropicalis


Alignment Length:162 Identity:36/162 - (22%)
Similarity:50/162 - (30%) Gaps:39/162 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 GHLYSATVAD------FSGGDPLIYRENLRTEQYDLKQLNQPDFVGAIERNGYVLFFFRELSMEV 251
            |.||.||.:.      |.|..|  .....:.|.:.|.||:  :.|...||||      .....:.
 Frog    28 GVLYEATCSGLARLEMFEGSQP--PDSGRKPECWKLLQLS--ECVSVSERNG------EGSPKDT 82

  Fly   252 MNFGKAVYSRVARVCKNDRGGPYSHGKSWT------SFLKARL----NCSVPGEFPFYFDEIQAI 306
            .:|......||..:.......|     .|.      :|.:.||    ..|.|.|...:..|.:..
 Frog    83 RSFCIETAQRVYLLASETSEQP-----GWVKALCSLAFPQERLPLERKTSQPPESGLHLQENELY 142

  Fly   307 SPIVESGSKSLIYAVFTTSVNAIPGSAVCAFN 338
            |...|:|        |...:.....|..|..|
 Frog   143 STTRETG--------FVVRIRPTEASVRCGLN 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 36/162 (22%)
PSI 510..>537 CDD:214655
dok2XP_002932742.2 PH-like 7..115 CDD:388408 22/101 (22%)
PH-like 150..244 CDD:388408 4/17 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.