DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Sema1b and sema3b

DIOPT Version :9

Sequence 1:NP_001163178.1 Gene:Sema1b / 37007 FlyBaseID:FBgn0016059 Length:770 Species:Drosophila melanogaster
Sequence 2:NP_001120908.1 Gene:sema3b / 100151737 XenbaseID:XB-GENE-921561 Length:773 Species:Xenopus tropicalis


Alignment Length:504 Identity:158/504 - (31%)
Similarity:243/504 - (48%) Gaps:61/504 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 LDHNDEFVLVGAKDVIYNVSLNGL-KEIARLEWHSTDADRELCALKGKH-EWDCHNYLRVYALRP 126
            ||.....:.||.|:.:.::||:.: |:...:.|.:....||.|...||. ..||.||:::  |:|
 Frog    57 LDEERGRLFVGGKNYLMSLSLDNISKQELAIHWPAPVEWREECNWAGKDINVDCMNYVKI--LQP 119

  Fly   127 NGEVLL--CGTNSYKPRCRHYTPVEVSSEEAGSAGHAH--------AMRYEVSRDVEAQGLCPYS 181
            .....|  |||.::.|.|                |..|        ..:.::.|..:.:|.|||.
 Frog   120 YNRTHLFTCGTGAFHPTC----------------GFVHVGQRTDDTVFKMDLRRMEDGKGRCPYD 168

  Fly   182 PAHNSTYAFADGHLYSATVADFSGGDPLIYRE-----NLRTEQYDLKQLNQPDFVGAI------- 234
            |.|.:........|||....|..|.|..|:|.     .|||||:|.:.||:|.||...       
 Frog   169 PKHIAAAVLVGDELYSGVATDLMGRDFTIFRSLGRRPPLRTEQHDSRWLNEPKFVKVFWIPESEN 233

  Fly   235 ERNGYVLFFFRELSMEVMNFGKAVYSRVARVCKNDRGGPYSHGKSWTSFLKARLNCSVPGE---F 296
            ..:..:.|||:|..:|.....|..|:|:.::|:||.||..|....||:||||||.|||||.   .
 Frog   234 PDDDKIYFFFKETPVEGAGGVKQSYARIGQICRNDLGGQRSLVNKWTTFLKARLVCSVPGNEIGG 298

  Fly   297 PFYFDEIQAISPIVESGSKS-LIYAVFTTSVNAIPGSAVCAFNVDDILAAFDGEFKSQKDSQSHW 360
            ..:|||::.:..:.....:: ||||:|:||.:...|||:|.:.::|:..||.|.|..::.....|
 Frog   299 DTHFDELRDVFLLQTRDRRNPLIYALFSTSSSVFRGSAICVYTMNDVRRAFLGPFAHKEGPNYQW 363

  Fly   361 LPVEREQVPKPRPGQC-------VEDSRTLTSIAVNFIKNHPLMEEAVPAVHGRPLLTKVNLHHR 418
            :..: .:||.||||.|       .|.:::.....:.|.:|||||...|....|||:..:.:....
 Frog   364 VSYQ-GKVPYPRPGMCPSKTFGSFESTKSFPDDVLQFARNHPLMFNPVVPGSGRPVFLRSHGDLS 427

  Fly   419 LTAIAVHPQVKSLSGAYYDVIYSGTDDGKVTKFINILSTHPNSTVDRLKTVVISEMQVLPLGTPI 483
            .|.:|| .:|.:..|. |||::.|||.|.|.|.|::    |..:...::.||:.|:||....:||
 Frog   428 FTQLAV-DRVAAADGE-YDVMFIGTDVGSVLKVISV----PKQSWHHVEQVVLEELQVFKNASPI 486

  Fly   484 RELVISTSKNSLVVVSDGSLVSVPLHHCS-HIVDCLGCLSLQDPICAWD 531
            ..:.||:.:..:.|.|...:..:|||.|. :...|..|...:||.||||
 Frog   487 TTMQISSKRQQIYVGSASGISQLPLHRCGIYGKACAECCLARDPYCAWD 535

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Sema1bNP_001163178.1 Sema_1A 55..511 CDD:200498 149/481 (31%)
PSI 510..>537 CDD:214655 9/23 (39%)
sema3bNP_001120908.1 Sema_3B 43..514 CDD:200511 149/481 (31%)
PSI 513..550 CDD:214655 9/23 (39%)
Ig 575..663 CDD:299845
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11036
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.