DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and AT1G80720

DIOPT Version :9

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001320214.1 Gene:AT1G80720 / 844411 AraportID:AT1G80720 Length:242 Species:Arabidopsis thaliana


Alignment Length:224 Identity:47/224 - (20%)
Similarity:77/224 - (34%) Gaps:69/224 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    81 IVAERKVQKGKTV----PSTLDGFAVKLTGADVELTKQTDKEKVVVSFNVNH------------- 128
            :::.|.:..|..|    .|...|..::|...::|             :.::|             
plant    38 LISRRCLSSGSYVSEMQKSAFQGNILRLIRNEIE-------------YELDHSPPLQPPNSFGPF 89

  Fly   129 TVD---SEEEPEINPN-ADKPDL--------------GEMRSKPQ------FEVDIIKGNST--L 167
            |||   .|:...:..| .||.|:              ...:::|:      |.|:|.|..:|  |
plant    90 TVDERPGEQWISLKRNFGDKEDIKIEATMFDRSVPTSKSTKTEPEYILHITFIVNISKAGATEAL 154

  Fly   168 SFTCSFLQGEAQEGEYNDVFSIDEMAIFEGEWNDKVYAVAG---DVLDGYLYDLLINLLEEKGIS 229
            ...||         .:.|...|.::.|..| .|....:..|   :.||..|.|.|...|||:|||
plant   155 EIMCS---------AWPDTIEISKLCIRRG-INTSPSSYGGPEFEELDDQLQDALYQFLEERGIS 209

  Fly   230 QEFAEKLSDLATAHEHTSYIGLLEKLSKF 258
            .|.|..|...........|:..:|.:..:
plant   210 DELAVFLHRYMKNKGKAEYVRWMESVKSY 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 68..253 CDD:280488 46/217 (21%)
AT1G80720NP_001320214.1 MAM33 69..233 CDD:396762 40/186 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D888304at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10826
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.