DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and AT4G31930

DIOPT Version :9

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_567885.1 Gene:AT4G31930 / 829323 AraportID:AT4G31930 Length:234 Species:Arabidopsis thaliana


Alignment Length:125 Identity:21/125 - (16%)
Similarity:49/125 - (39%) Gaps:24/125 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 PNADKPDLGEMRSKPQFEVDIIK-GNSTLSFTCSFLQGEAQEGEYNDVFSI-----DEMAIFEGE 198
            ||....|:....:|..|..:|:: ..:.:.:...:........|:.. ||:     ::..:.:|:
plant    33 PNHQSRDVTTSPAKSPFRSNILRIIRNEIEYQSDYAPPHQPATEFKS-FSVEDCPGEQCIVMKGK 96

  Fly   199 W-NDKVYAVAGDVLDGYLYDLLINLLEEKGISQEFAEKLSDLATAHEHTSYIGLLEKLSK 257
            : .|:...:...:.||::.      :...|:.          |:.|:...:|.||..:||
plant    97 FGEDEDIKMEATMFDGFMN------VPRAGLD----------ASGHDVRLHISLLVDISK 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 68..253 CDD:280488 18/119 (15%)
AT4G31930NP_567885.1 MAM33 60..226 CDD:280488 15/98 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D888304at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10826
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.