DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and AT3G55605

DIOPT Version :9

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_567025.1 Gene:AT3G55605 / 824726 AraportID:AT3G55605 Length:258 Species:Arabidopsis thaliana


Alignment Length:210 Identity:41/210 - (19%)
Similarity:79/210 - (37%) Gaps:34/210 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 KCERELVEFLTEEIVAERKVQKGKTVPSTLDG--FAVKLTG----ADVELTKQTDKEKVVVSFNV 126
            |.::.|::.:..||....:.........|:|.  |..|:..    ..|.||::.:.|::.|..::
plant    61 KSDQTLIQVIDSEIKDSFEADDHDADEETIDSSDFPFKIEDNPGHRTVTLTREYNGEQIKVEVSM 125

  Fly   127 NHTVDSEEEPEINPNADKPDLGEMRSKPQFEVDI-------IKGNSTLSFTCSFLQGE-----AQ 179
            ......|.|.:::.:.|    |:.|.:...|..|       .|...:|.|:|:....|     ..
plant   126 PGLAMDENEDDVDDDED----GDGRHEKSNESSIPLVVTVTKKSGLSLEFSCTAFPDEIVIDGLS 186

  Fly   180 EGEYNDVFSIDEMAIFEG-EWNDKVYAVAGDVLDGYLYDLLINLLEEKGISQEFAEKLSDLATAH 243
            ....:|  |.:|...::| ::.:         ||..:.......||.:||.....:.|.:.....
plant   187 VNRPDD--SSEEQLTYDGPDFQE---------LDENMRKSFHKFLETRGIKASATDFLYEYMMKK 240

  Fly   244 EHTSYIGLLEKLSKF 258
            :...|:..|:||..|
plant   241 DSREYLLWLKKLKTF 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 68..253 CDD:280488 37/203 (18%)
AT3G55605NP_567025.1 MAM33 70..250 CDD:396762 35/194 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D888304at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR10826
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.110

Return to query results.
Submit another query.