DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and AT2G41600

DIOPT Version :10

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001324354.1 Gene:AT2G41600 / 818758 AraportID:AT2G41600 Length:230 Species:Arabidopsis thaliana


Alignment Length:206 Identity:50/206 - (24%)
Similarity:74/206 - (35%) Gaps:49/206 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ELVEFLTEEIVAE------RKVQKGKTVPSTLDGFAVKLTGADVELTKQTDK-EKVVVSFNVNHT 129
            :|::.|..||..|      :.|:.|......||..:.:  ..|:.|.:|.|. ||||||..:...
plant    42 DLLKILQSEIRHEISHPRFQGVETGSLGDFKLDWDSPE--SQDIVLKRQFDSGEKVVVSALLQPE 104

  Fly   130 VDSEEEPEINPN-------ADKPDLGEMRSKPQFEVDIIKGNSTLSFTCSFLQGEAQEGEYNDVF 187
            ....|:..:.|.       ..||.|                :|.|.|.|...    :.|..:..|
plant   105 PIELEDDLVFPREAHAKVCIKKPGL----------------SSILQFHCRVY----ESGSGSSHF 149

  Fly   188 SIDEMAIFEGEWNDKVYAVAGD----VLDGYLYDLLINLLEEKGISQEFAEKLSDLATAH----E 244
            .| |.|.|...:.....:..||    .:|..|:..|...|..||:|    |.|::....|    |
plant   150 DI-ESAYFIRSFVSAPSSTYGDHFFSQVDPKLHSALEQYLISKGVS----EGLTNFLLCHLNKKE 209

  Fly   245 HTSYIGLLEKL 255
            ...|:..|.:|
plant   210 QDQYVNWLRRL 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 77..258 CDD:460534 49/201 (24%)
AT2G41600NP_001324354.1 MAM33 47..222 CDD:460534 49/201 (24%)

Return to query results.
Submit another query.