DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and C1QBP

DIOPT Version :9

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001203.1 Gene:C1QBP / 708 HGNCID:1243 Length:282 Species:Homo sapiens


Alignment Length:272 Identity:95/272 - (34%)
Similarity:143/272 - (52%) Gaps:30/272 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ATMRFAALASSSAGSLGKRDFTRSLWHMTKKP-----VTAGGSDHVTVLNLHKPSINCTCGC--- 63
            |.:|.||.||..      |...:....:..:|     |.||......:|   :|...|.|||   
Human    17 AGLRAAAPASPF------RQLLQPAPRLCTRPFGLLSVRAGSERRPGLL---RPRGPCACGCGCG 72

  Fly    64 NVHTKCERELVEFLTEEIVAERKVQKGKTVPSTLDGFAVKLTGADVELTKQTDKEKVVVSFNVNH 128
            ::||..::..|:||::||..|||:||.||:|....|:.::|.|.:.:|.::...||:.|:||:|:
Human    73 SLHTDGDKAFVDFLSDEIKEERKIQKHKTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINN 137

  Fly   129 ----TVDSEEEPEINPNADKPDLGEMRSKPQFEVDIIK---GNSTLSFTCSFLQGE-AQEGE-YN 184
                |.|.||||......::.: .|:.|.|.|.|::||   |...|...|.:.:.| .||.| .:
Human   138 SIPPTFDGEEEPSQGQKVEEQE-PELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAES 201

  Fly   185 DVFSIDEMAI---FEGEWNDKVYAVAGDVLDGYLYDLLINLLEEKGISQEFAEKLSDLATAHEHT 246
            |:|||.|::.   .|.||.|..|.:..|.||..|||.|::.|.::|:...||::|.:|:||.||.
Human   202 DIFSIREVSFQSTGESEWKDTNYTLNTDSLDWALYDHLMDFLADRGVDNTFADELVELSTALEHQ 266

  Fly   247 SYIGLLEKLSKF 258
            .||..||.|..|
Human   267 EYITFLEDLKSF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 68..253 CDD:280488 72/196 (37%)
C1QBPNP_001203.1 C1q binding 76..93 6/16 (38%)
MAM33 89..273 CDD:280488 69/184 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 138..164 7/26 (27%)
Interaction with MAVS. /evidence=ECO:0000269|PubMed:19164550 168..213 16/44 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165142988
Domainoid 1 1.000 122 1.000 Domainoid score I5655
eggNOG 1 0.900 - - E1_KOG4024
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H31023
Inparanoid 1 1.050 140 1.000 Inparanoid score I4502
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48658
OrthoDB 1 1.010 - - D504912at33208
OrthoFinder 1 1.000 - - FOG0006976
OrthoInspector 1 1.000 - - oto89319
orthoMCL 1 0.900 - - OOG6_107765
Panther 1 1.100 - - LDO PTHR10826
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R681
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.