DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment P32 and AT4G32605

DIOPT Version :9

Sequence 1:NP_611243.1 Gene:P32 / 37006 FlyBaseID:FBgn0034259 Length:263 Species:Drosophila melanogaster
Sequence 2:NP_001078481.1 Gene:AT4G32605 / 5008179 AraportID:AT4G32605 Length:227 Species:Arabidopsis thaliana


Alignment Length:251 Identity:51/251 - (20%)
Similarity:84/251 - (33%) Gaps:72/251 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 HMTKKPVT--AGGSDHVTVLNLHKPSINCTCGCNVHTKCERELVEFLTEEIVAERKVQKGKTV-- 93
            |..::.::  ||||..               ..||....:..|:..|.|..:...|:.....|  
plant    13 HQLQRALSSKAGGSGK---------------SANVSAAVDSMLLRSLKEHYLEVSKMTPPPKVSP 62

  Fly    94 PSTLD---GFAVKLTGADVELTKQTDKEKV-VVSFNVNHTVDSEEEPEIN----------PNADK 144
            ||..:   |.....|||  .|.|....|:: :....:.|..|.|::..||          ||  :
plant    63 PSPFEIVKGSLEGSTGA--VLKKSVGNEEINLFVMRLAHGGDEEDDGGINQLFLHVAVSKPN--Q 123

  Fly   145 PDLGEMRSKPQFEVDIIKGNSTLSFTCSFLQGEAQEGEYNDVFSIDEMAI---FEG-EWNDKVYA 205
            ||                   :|.|.|         |.|.|...|..:::   .|. |.:|....
plant   124 PD-------------------SLHFLC---------GLYPDALGIHSVSMRPKLEALEMSDDPTQ 160

  Fly   206 VAG---DVLDGYLYDLLINLLEEKGISQEFAEKLSDLATAHEHTSYIGLLEKLSKF 258
            ..|   :.||..:.|:....|||:|:::.....|.......:|.:.:...:.:..|
plant   161 YTGPSFEELDEKMRDVFHGFLEERGVNESLFPFLQAWLYVKDHRNLLRWFKSVGTF 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
P32NP_611243.1 MAM33 68..253 CDD:280488 43/207 (21%)
AT4G32605NP_001078481.1 MAM33 66..209 CDD:367037 36/174 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D888304at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.