DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprh

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_109651.1 Gene:Mrgprh / 80978 MGIID:1934134 Length:321 Species:Mus musculus


Alignment Length:346 Identity:83/346 - (23%)
Similarity:148/346 - (42%) Gaps:65/346 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLI-- 103
            |||     |.:||..|..:.|   ....||.:........||.:..|  :|..:|:.|||.||  
Mouse     4 LAM-----TLYPLESTQPTRN---KTPNETTWSSEHTDDHTYFLVSL--VICSLGLAGNGLLIWF 58

  Fly   104 VVFLSVRQMRNVPNT-YILSLALADLLVII--TTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSI 165
            ::|...|:    |.| |||.||:||.:|::  :.:.|.:|.:.     |...|.|.:........
Mouse    59 LIFCIKRK----PFTIYILHLAIADFMVLLCSSIMKLVNTFHI-----YNMTLESYAILFMIFGY 114

  Fly   166 GVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHL 230
            ...:..|||:|.:|..:::.|: .:..    :|....:....:.:|.|::|.       |.|:  
Mouse   115 NTGLHLLTAISVERCLSVLYPI-WYQC----QRPKHQSAVACMLLWALSVLV-------SGLE-- 165

  Fly   231 GINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIA--VFYVLIALHLMYSASVPGEIQ 293
              |...|:...|...|....|..|.:|. |||:  :||::.:  :.::.:..:|           
Mouse   166 --NFFCILEVKPQFPECRYVYIFSCILT-FLVF--VPLMIFSNLILFIQVCCNL----------- 214

  Fly   294 GAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFAN 358
                :.|...|:.|.::..|::|.:..:|..|..:..|:..:..|   :.|..|..: ..:|..|
Mouse   215 ----KPRQPTKLYVIIMTTVILFLVFAMPMKVLLIIGYYSSSLDD---SVWDSLPYL-NMLSTIN 271

  Fly   359 SCANPVALYFVSGAFRKHFNR 379
            ...||: :|||.|:.|:..:|
Mouse   272 CSINPI-VYFVVGSLRRKRSR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/104 (29%)
7tm_1 98..364 CDD:278431 61/272 (22%)
MrgprhNP_109651.1 7tm_4 42..>215 CDD:304433 50/217 (23%)
7tm_1 51..279 CDD:278431 62/275 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.