DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and TACR3

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001050.1 Gene:TACR3 / 6870 HGNCID:11528 Length:465 Species:Homo sapiens


Alignment Length:472 Identity:115/472 - (24%)
Similarity:208/472 - (44%) Gaps:88/472 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IANLVSMET--DLAMNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQW-PLLDTGS--SEN 61
            :|.|.:.||  |....:|.|.           .|:|.:|...|...:..|.| .|||...  |.:
Human     1 MATLPAAETWIDGGGGVGADA-----------VNLTASLAAGAATGAVETGWLQLLDQAGNLSSS 54

  Fly    62 FSEL---VTTETPYVPYGRRPETYIVP--------ILFALIFVVGVLGNGTLIVVFLSVRQMRNV 115
            .|.|   |.:..|..|:......::.|        :.:.::..|.||||..:|.:.|:.::||.|
Human    55 PSALGLPVASPAPSQPWANLTNQFVQPSWRIALWSLAYGVVVAVAVLGNLIVIWIILAHKRMRTV 119

  Fly   116 PNTYILSLALADL-LVIITTVPLASTVYTV-EYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGD 178
            .|.::::||.:|. :....|  |.:.:|.: ..|.:|:..|....|....::..|::::||::.|
Human   120 TNYFLVNLAFSDASMAAFNT--LVNFIYALHSEWYFGANYCRFQNFFPITAVFASIYSMTAIAVD 182

  Fly   179 RYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICY-P 242
            ||.||:|||:.       |.:...|.....|||:||.|...|..:.|..|.:    ....:|: .
Human   183 RYMAIIDPLKP-------RLSATATKIVIGSIWILAFLLAFPQCLYSKTKVM----PGRTLCFVQ 236

  Fly   243 YPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAV-RQVRARRKVA 306
            :||....::...::::  ::.|..||:::.:.|.::.:.| :...:||:..... .|::|:|||.
Human   237 WPEGPKQHFTYHIIVI--ILVYCFPLLIMGITYTIVGITL-WGGEIPGDTCDKYHEQLKAKRKVV 298

  Fly   307 VTVLAFVVIFGICFLPYHVFFL----------WFYFWPTAQDDYNA-FWHVLRIVAYCMSFANSC 360
            ..::..|:.|.||:||||::|:          |.|.    |..|.| ||         ::.:::.
Human   299 KMMIIVVMTFAICWLPYHIYFILTAIYQQLNRWKYI----QQVYLASFW---------LAMSSTM 350

  Fly   361 ANPVALYFVSGAFRKHFNR-YLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCYQS 424
            .||:....::..||..|.| :.:|...     |...:|      :..|.:|   ||.........
Human   351 YNPIIYCCLNKRFRAGFKRAFRWCPFI-----KVSSYD------ELELKTT---RFHPNRQSSMY 401

  Fly   425 TIRSCRLQETTITTLPN 441
            |:  .|::..|:...||
Human   402 TV--TRMESMTVVFDPN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 31/101 (31%)
7tm_1 98..364 CDD:278431 72/280 (26%)
TACR3NP_001050.1 7tmA_NKR_NK3R 86..367 CDD:320669 78/309 (25%)
TM helix 1 87..113 CDD:320669 7/25 (28%)
TM helix 2 120..146 CDD:320669 6/27 (22%)
TM helix 3 158..188 CDD:320669 9/29 (31%)
TM helix 4 199..220 CDD:320669 8/20 (40%)
TM helix 5 244..273 CDD:320669 4/30 (13%)
TM helix 6 292..322 CDD:320669 13/29 (45%)
TM helix 7 335..360 CDD:320669 7/33 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 415..465 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.