DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and gpr37b

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001137521.1 Gene:gpr37b / 568430 ZFINID:ZDB-GENE-041210-264 Length:611 Species:Danio rerio


Alignment Length:343 Identity:84/343 - (24%)
Similarity:142/343 - (41%) Gaps:54/343 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 VTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLV 130
            ||:||    ||    .|.:.|:..|||.||:.||..::.|......||::.|..:.:||:.|..:
Zfish   248 VTSET----YG----AYAITIISVLIFAVGITGNIAIMCVVCHNYYMRSISNALLANLAIWDFAL 304

  Fly   131 IITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGG 195
            ::..:||.......:.|..|.|.|.:..:::..|:||:.|||.||..||:               
Zfish   305 LLFCLPLVVFHQLTKTWLLGQFTCKVVPYIEVASLGVTTFTLCALCIDRF--------------- 354

  Fly   196 GRRATRM------------TLATAVSIWLLAILCGLPALI--------GSNLKHLGINEKSIV-I 239
             |.||.:            |.|....||:.|:|..||.|:        |.|......:|:.:: |
Zfish   355 -RAATNVQMYYEMIENCTSTAAKLAVIWIGALLLALPELLIRQLVSENGDNTVDDPTSERCLIRI 418

  Fly   240 CYPYPEE---WGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRA 301
            ....|:.   .|:.|..:.:...|..|:.:|.:......|..|..:..:..  |..:|..:|:|.
Zfish   419 STSLPDTLYVLGLTYEGARLWWCFGCYFCLPTLFTIGSSVATARRIRRAER--GCARGNKKQIRL 481

  Fly   302 RRKVAVTVLAFVVIFGICFLPYHVF-FLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVA 365
            ..::..||:|..:::|.|.:|.:|. .:..|..........|..|:|   :..:.|..:...||.
Zfish   482 ESQMNCTVVALAIVYGACVVPENVCNMVSAYMAAGVPQSTMALLHLL---SQLLLFLRAAVTPVL 543

  Fly   366 LYFVSGAFRKHFNRYLFC 383
            |..:...|.:.|.....|
Zfish   544 LLCLCRPFGRAFLECCCC 561

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/99 (30%)
7tm_1 98..364 CDD:278431 65/290 (22%)
gpr37bNP_001137521.1 7tm_1 272..522 CDD:278431 61/267 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.