DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and ednrbb

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_688565.1 Gene:ednrbb / 560081 ZFINID:ZDB-GENE-081105-182 Length:408 Species:Danio rerio


Alignment Length:317 Identity:95/317 - (29%)
Similarity:151/317 - (47%) Gaps:29/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 YIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTV-- 144
            ||..::..::|::|:|||.||:.:....:.||..||..|.||||.|:|.|:..:|:  .||.:  
Zfish    60 YISSVVSCVVFLLGMLGNITLLTIIKEHKCMRKGPNIVIGSLALGDILHIVIGLPV--NVYKILA 122

  Fly   145 EYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVS 209
            ..||:|...|.|..|::..|:|::|.:|..||.|||..:....|.     .|....:.||.....
Zfish   123 VDWPFGVVFCKLVPFIQKTSVGITVLSLCVLSIDRYRVVSSRSRI-----KGPSFPKWTLIKLCV 182

  Fly   210 IWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWG-----INYAKSMVLLHFLVYYAIPLV 269
            ||:::.....|..:..:...:....:.:.||..:|.:..     ...||...||  |.|:..||.
Zfish   183 IWVISAFLAAPEAVAFDQITMDYRGERLRICLLHPVQNNAFMQFYKVAKDWWLL--LFYFVFPLS 245

  Fly   270 VIAVFYVLIALHLMYSASVPGEIQGAVRQVR-ARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFW 333
            ..||||.|:...::...      |.|:.:.| .||:||.||...|::|.:|:.|.|:..:.....
Zfish   246 CTAVFYSLMTWRILRVQ------QSALHKHRKQRREVARTVFCLVLVFAVCWFPLHLSRILRMIL 304

  Fly   334 PTAQDDYN----AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLF--CR 384
            ...||...    :.:.||..:...|:..|||.||||||.||..::.:|...|:  |:
Zfish   305 YDEQDPDRCRLLSTFLVLDYIGLNMASINSCINPVALYVVSKRYKNYFREALWRCCK 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 37/101 (37%)
7tm_1 98..364 CDD:278431 80/277 (29%)
ednrbbXP_688565.1 7tm_1 76..339 CDD:278431 80/277 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.