DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Rh2

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_524398.1 Gene:Rh2 / 42261 FlyBaseID:FBgn0003248 Length:381 Species:Drosophila melanogaster


Alignment Length:377 Identity:85/377 - (22%)
Similarity:153/377 - (40%) Gaps:81/377 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 NVTETLWDLAMVVSQSTQWPLLDTGSSENFSEL--VTTETPYV--PYGRR-----PETYIVPILF 88
            ::.||.:|||      ...|.....||.|.|.|  |..:..::  ||..|     |....:..||
  Fly     5 HLPETPFDLA------HSGPRFQAQSSGNGSVLDNVLPDMAHLVNPYWSRFAPMDPMMSKILGLF 63

  Fly    89 AL-IFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSF 152
            .| |.::...|||.::.:|...:.:|...|..:|:||.:|..::.:..|:....:..|.|..|..
  Fly    64 TLAIMIISCCGNGVVVYIFGGTKSLRTPANLLVLNLAFSDFCMMASQSPVMIINFYYETWVLGPL 128

  Fly   153 LCSLSEFMKDVSIG-------VSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVS- 209
            .|       |:..|       ||::::..::.|||..||.          |...|.||:.|::. 
  Fly   129 WC-------DIYAGCGSLFGCVSIWSMCMIAFDRYNVIVK----------GINGTPMTIKTSIMK 176

  Fly   210 ---IWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINY------AKSMVLLHFLVYYA 265
               ||::|:...:..|||.:..   :.|.::..|       .|:|      .:|.::.:.|..|.
  Fly   177 ILFIWMMAVFWTVMPLIGWSAY---VPEGNLTAC-------SIDYMTRMWNPRSYLITYSLFVYY 231

  Fly   266 IPLVVIAV-FYVLIALHLMYSASVPGEIQGA-VRQVR--------ARRKVAVTVLAFVVIFGICF 320
            .||.:|.. ::.:||....:..::..:.:.. |:.:|        |..|:|...|..:.::.:.:
  Fly   232 TPLFLICYSYWFIIAAVAAHEKAMREQAKKMNVKSLRSSEDCDKSAEGKLAKVALTTISLWFMAW 296

  Fly   321 LPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCA--NPVALYFVS 370
            .||.|...:..|...........|..        :||.:.|  ||: :|.:|
  Fly   297 TPYLVICYFGLFKIDGLTPLTTIWGA--------TFAKTSAVYNPI-VYGIS 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 27/107 (25%)
7tm_1 98..364 CDD:278431 62/294 (21%)
Rh2NP_524398.1 7tm_4 67..>237 CDD:304433 45/196 (23%)
7tm_1 74..336 CDD:278431 63/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR45695
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.