DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and PK1-R

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001014620.1 Gene:PK1-R / 41713 FlyBaseID:FBgn0038201 Length:430 Species:Drosophila melanogaster


Alignment Length:459 Identity:108/459 - (23%)
Similarity:183/459 - (39%) Gaps:118/459 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 RRPETYIVP--ILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLAS 139
            |.|...::|  ::::|||:.||:||.:..:|....|.|....|.|:.|||::|.|::::.|| ..
  Fly    14 RDPLAIVIPVTVVYSLIFITGVVGNISTCIVIKKNRSMHTATNYYLFSLAISDFLLLLSGVP-QE 77

  Fly   140 TVYTVEYWPY--GSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRM 202
            ..|....:||  |.::|.....:.:.|...:|.|:||.:.:||.||..|..       |:..:::
  Fly    78 VSYIWSKYPYVFGEYICIGRGLLAETSANATVLTITAFTVERYIAICHPFL-------GQAMSKL 135

  Fly   203 TLA--TAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGI--NYAKSMVLLHFLVY 263
            :.|  ..|.:|::||:..:|......::|           |...|:.||  ...|....|...::
  Fly   136 SRAIRIIVLVWIMAIVTAIPQAAQFGIEH-----------YSGVEQCGIVRVIVKHSFQLSTFIF 189

  Fly   264 YAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQ------------------------------ 298
            :..|:.:|.|.|:||.:||..|..|.|....|.||                              
  Fly   190 FLAPMSIILVLYLLIGVHLYRSTLVEGPASVARRQQLKSVPSDTILYRYGGSGTAMSFNGGGSGA 254

  Fly   299 ---------------VRAR------RKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPT----AQD 338
                           ||.|      |:|...::|.||.|.:|:.|:|...|...:.|.    .:|
  Fly   255 GTAGLMGGSGAQLSSVRGRLNHYGTRRVLRMLVAVVVCFFLCWAPFHAQRLIAIYAPARGAKLRD 319

  Fly   339 DYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGASGRRKKRGQHDTFCMHR 403
            .:...:.|:..|:..:.:.::|.||:....:|..||:.|...||     |::..:|         
  Fly   320 QHEFVYTVMTYVSGVLYYLSTCINPLLYNIMSHKFREAFKAVLF-----GKKVSKG--------- 370

  Fly   404 DTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTLPNGGNQNGANISAVELALPVLQAPGHNEA 468
              ||.|             ::.|.|.||:.    .|.|.......:|.:.|...|.:.   .|..
  Fly   371 --SLNS-------------RNNIESRRLRR----ALTNSSQTQRFSIESAEQPKPSIM---QNPT 413

  Fly   469 HAPP 472
            :.||
  Fly   414 NKPP 417

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 34/101 (34%)
7tm_1 98..364 CDD:278431 76/326 (23%)
PK1-RNP_001014620.1 7tmA_capaR 21..358 CDD:320262 86/355 (24%)
TM helix 1 21..48 CDD:320262 9/26 (35%)
TM helix 2 55..81 CDD:320262 9/26 (35%)
TM helix 3 94..124 CDD:320262 9/29 (31%)
TM helix 4 136..158 CDD:320262 6/21 (29%)
TM helix 5 178..207 CDD:320262 8/28 (29%)
TM helix 6 277..307 CDD:320262 10/29 (34%)
TM helix 7 326..351 CDD:320262 5/24 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438997
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.