DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and PK2-R1

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_731790.1 Gene:PK2-R1 / 41639 FlyBaseID:FBgn0038140 Length:660 Species:Drosophila melanogaster


Alignment Length:523 Identity:120/523 - (22%)
Similarity:211/523 - (40%) Gaps:121/523 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 IANLVSMETDLAMNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSENFSELV 66
            :|:|:::.|:...|:...|:|...:.:.....|.|:|                            
  Fly    68 VAHLLNITTENLSNLLGSTNGTNASTMAADSPVDESL---------------------------- 104

  Fly    67 TTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVI 131
            |..|            .:.:.:|||||.|||||....:|......|....|.|:.:||::||:::
  Fly   105 TLRT------------ALTVCYALIFVAGVLGNLITCIVISRNNFMHTATNFYLFNLAVSDLILL 157

  Fly   132 ITTVPLASTVYTVEY---WPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAH 193
            ::.:|  ..:|.:.|   :|:...:|.:...:.:::...:|.|:||.:.:||.||..|.|: |..
  Fly   158 VSGIP--QELYNLWYPDMYPFTDAMCIMGSVLSEMAANATVLTITAFTVERYIAICHPFRQ-HTM 219

  Fly   194 GGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGIN-------Y 251
            ....||.:...|    |||.|.|..||..:          :.|:|    |..| |.:       |
  Fly   220 SKLSRAIKFIFA----IWLAAFLLALPQAM----------QFSVV----YQNE-GYSCTMENDFY 265

  Fly   252 AKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYS---ASVPGEIQGAVRQVRARRKVAVTVLAFV 313
            |....:..| :::..|:..|.|.||||.:.|..|   .|:|.....|.|.:.|:.:|...::|..
  Fly   266 AHVFAVSGF-IFFGGPMTAICVLYVLIGVKLKRSRLLQSLPRRTFDANRGLNAQGRVIRMLVAVA 329

  Fly   314 VIFGICFLPYH------VFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGA 372
            |.|.:|:.|:|      |:.|.......::|.:|.::.:|...:..:.|.::|.||:....:|..
  Fly   330 VAFFLCWAPFHAQRLMAVYGLNLINIGISRDAFNDYFRILDYTSGVLYFLSTCINPLLYNIMSHK 394

  Fly   373 FRKHF-----NRYLFCRGASGRRKKRGQHD---------------TFCMHRDTSLTSTASKR--- 414
            ||:.|     .::...|....::.:..||:               ..|...:.:|....|.|   
  Fly   395 FREAFKITLTRQFGLARNHHHQQSQHHQHNYSALLRQNGSMRLQPASCSVNNNALEPYGSYRVVQ 459

  Fly   415 FQSRHSCYQSTIRSCRLQETTITTLPN-------------GGNQNGANISAVELALPVLQAPGHN 466
            |:.|.:.:|.:::......||.||:.:             ||...|..:...||..|   .||..
  Fly   460 FRCRDANHQLSLQDSIRTTTTTTTINSNSMAAGNGVGGGAGGGGGGRRLRKQELYGP---GPGTA 521

  Fly   467 EAH 469
            ..|
  Fly   522 VPH 524

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/102 (31%)
7tm_1 98..364 CDD:278431 73/284 (26%)
PK2-R1NP_731790.1 7tm_4 114..>242 CDD:304433 42/134 (31%)
7tm_1 124..388 CDD:278431 74/286 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438991
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.