DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and PK2-R2

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_731788.1 Gene:PK2-R2 / 41638 FlyBaseID:FBgn0038139 Length:599 Species:Drosophila melanogaster


Alignment Length:425 Identity:110/425 - (25%)
Similarity:185/425 - (43%) Gaps:50/425 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 ELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADL 128
            ||:.|.||..|...   ...:.:.:||||:.|||||....:|......|....|.|:.:||::|:
  Fly    52 ELLPTVTPMTPLSL---LATLSVGYALIFIAGVLGNLITCIVISRNNFMHTATNFYLFNLAISDM 113

  Fly   129 LVIITTVPLASTVYTV---EYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKF 190
            :::.:.:|  ..:|.:   :.:|:...:|.|...:.:.:...:|.|:||.:.:||.||..|.|: 
  Fly   114 ILLCSGMP--QDLYNLWHPDNYPFSDSICILESVLSETAANATVLTITAFTVERYIAICHPFRQ- 175

  Fly   191 HAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSM 255
            |......||.:...|    ||:.|:|..||..|..::...|:...    |....:.:...:|.|.
  Fly   176 HTMSKLSRAVKFIFA----IWIAALLLALPQAIQFSVVMQGMGTS----CTMKNDFFAHVFAVSG 232

  Fly   256 VLLHFLVYYAIPLVVIAVFYVLIALHLMYS---ASVPGEIQGAVRQVRARRKVAVTVLAFVVIFG 317
            .|     ::..|:..|.|.||||.:.|..|   .::|.......|.:.|:.:|...::|..|.|.
  Fly   233 FL-----FFGGPMTAICVLYVLIGVKLKRSRLLQALPRRCYDVNRGISAQTRVIRMLVAVAVAFF 292

  Fly   318 ICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAY---CMSFANSCANPVALYFVSGAFRKHFN- 378
            ||:.|:|...|...:..|:..:...|..|..|:.|   .:.|.::|.||:....:|..||:.|. 
  Fly   293 ICWAPFHAQRLMAVYGSTSGIESQWFNDVFSILDYTSGVLYFLSTCINPLLYNIMSHKFREAFKV 357

  Fly   379 ---RYLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTLP 440
               |:.   |..|:.:.||...|:...|   ...|.|.|..:..|     :|:......|.||..
  Fly   358 TLARHF---GLGGKNQGRGLPHTYSALR---RNQTGSLRLHTTDS-----VRTTMTSMATTTTGL 411

  Fly   441 NG-------GNQNGANISAVELALPVLQAPGHNEA 468
            ||       |...|.::....::|..:|..|.|.:
  Fly   412 NGSANGSGNGTTTGQSVRLNRVSLDSVQMQGQNRS 446

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/102 (29%)
7tm_1 98..364 CDD:278431 69/274 (25%)
PK2-R2NP_731788.1 7tm_1 83..344 CDD:278431 70/276 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45438993
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.