DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and MAS1

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001353633.1 Gene:MAS1 / 4142 HGNCID:6899 Length:325 Species:Homo sapiens


Alignment Length:364 Identity:79/364 - (21%)
Similarity:147/364 - (40%) Gaps:81/364 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFSELVTTETPYVPYGRRPET----YIVPILFALIF---VVGVLGNGTLIVVFLSVRQMRNVPNT 118
            |.:..|..|...:..||....    ..:||:..:|.   .||.:.|| :::.||..|..||....
Human     5 NVTSFVVEEPTNISTGRNASVGNAHRQIPIVHWVIMSISPVGFVENG-ILLWFLCFRMRRNPFTV 68

  Fly   119 YILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVS--------VFTLTAL 175
            ||..|::||:.::. .:.:.|..|.::|      ..|...:...|::.|:        ::.|||:
Human    69 YITHLSIADISLLF-CIFILSIDYALDY------ELSSGHYYTIVTLSVTFLFGYNTGLYLLTAI 126

  Fly   176 SGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVIC 240
            |.:|..:::.|: .:..|   |...:..|..|: :|.|:.|               :.....|:|
Human   127 SVERCLSVLYPI-WYRCH---RPKYQSALVCAL-LWALSCL---------------VTTMEYVMC 171

  Fly   241 YPYPEEWGINYAKS--------MVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVR 297
            ....||   :::::        :.:|.|||:..:.||...:..|.|..:...|.|          
Human   172 IDREEE---SHSRNDCRAVIIFIAILSFLVFTPLMLVSSTILVVKIRKNTWASHS---------- 223

  Fly   298 QVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFY-FWPTAQDDYNAFWHVLRIVAYCMSFANSCA 361
                 .|:.:.::..::||.|..:|..:.:|.:| :|.|..:        |..::...|..||.|
Human   224 -----SKLYIVIMVTIIIFLIFAMPMRLLYLLYYEYWSTFGN--------LHHISLLFSTINSSA 275

  Fly   362 NPVALYFVSGAFRKHFN---RYLFCRGASGRRKKRGQHD 397
            ||...:||..:.:|.|.   :.:..|......:.|.|.|
Human   276 NPFIYFFVGSSKKKRFKESLKVVLTRAFKDEMQPRRQKD 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 27/110 (25%)
7tm_1 98..364 CDD:278431 60/282 (21%)
MAS1NP_001353633.1 7tmA_MrgprH 33..307 CDD:320238 71/327 (22%)
TM helix 1 34..60 CDD:320238 8/26 (31%)
TM helix 2 66..89 CDD:320238 5/23 (22%)
TM helix 3 107..135 CDD:320238 6/27 (22%)
TM helix 4 147..167 CDD:320238 5/35 (14%)
TM helix 5 192..217 CDD:320238 8/24 (33%)
TM helix 6 221..251 CDD:320238 8/44 (18%)
TM helix 7 259..284 CDD:320238 8/32 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.