DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprb4

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001002287.1 Gene:Mrgprb4 / 404658 RGDID:738043 Length:323 Species:Rattus norvegicus


Alignment Length:346 Identity:89/346 - (25%)
Similarity:147/346 - (42%) Gaps:79/346 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 VSQSTQ-WPLLDTGSSEN-FSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFL 107
            :|.:|| |.:.:|...|| ::|:::..|.:         ..:..|..:|.|||:.||.| ::..|
  Rat     1 MSPTTQAWSINNTVVKENYYTEILSCITTF---------NTLNFLIVIISVVGMAGNAT-VLWLL 55

  Fly   108 SVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVE---YWPYGSFLCSLSEFMKDVSIGVSV 169
            .....||..:.|:|:||.||.|.:     .|.|||::|   .:....|...|:..|.:...|..:
  Rat    56 GFHMHRNAFSVYVLNLAGADFLYL-----CAQTVYSLECVLQFDNSYFYFLLTILMFNYLAGFCM 115

  Fly   170 FTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSI-WLLAILCGLPALIGSNLKHLGIN 233
              :.|:|.:|..::..|: .:|.     :..|.|.||..:: |..::|..|  |:|.        
  Rat   116 --IAAISTERCLSVTWPI-WYHC-----QRPRHTSATVCALFWAFSLLLSL--LLGQ-------- 162

  Fly   234 EKSIVICYPYPEEWGINYAKSMVLLHFLVY--YAIPLVVIAVFYVLIALHLMYSASVPGEIQGAV 296
                          |..:..|.....|..|  :.....:|.:|.||....|...|.:   |.|:.
  Rat   163 --------------GCGFLFSKFDYSFCRYCNFIATAFLIVIFMVLFVSSLALLAKI---ICGSH 210

  Fly   297 R--QVRARRKVAVTVLAFVVI---FGICFLPYHVFFL-WFYFWPTAQDDYNAFWHVLRIVAYCMS 355
            |  ..|....:|:|||.|:..   .|||     ||.| |.:..      .::|::.:..:..|: 
  Rat   211 RIPVTRFYVTIALTVLVFIFFGLPIGIC-----VFLLPWIHMM------LSSFFYEMVTLLSCV- 263

  Fly   356 FANSCANPVALYFVSGAFRKH 376
              ||||||: :||..|:.|.|
  Rat   264 --NSCANPI-IYFFVGSIRHH 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 30/102 (29%)
7tm_1 98..364 CDD:278431 69/277 (25%)
Mrgprb4NP_001002287.1 7tm_4 38..>201 CDD:304433 49/200 (25%)
7tm_1 47..272 CDD:278431 70/280 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 298..323
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.