DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprx2l

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001002285.1 Gene:Mrgprx2l / 404645 RGDID:738053 Length:314 Species:Rattus norvegicus


Alignment Length:323 Identity:75/323 - (23%)
Similarity:132/323 - (40%) Gaps:94/323 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVI-------------ITTVPL 137
            |..:||..:.||....:::..|..:..||..:.|||:||.||.|.|             |.|:|:
  Rat    12 IFLSLIIAIVVLVGNAIVIWLLGFQMCRNAFSIYILNLAGADFLFIGFQIGYCFYIIFDIYTIPI 76

  Fly   138 ASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRM 202
            ...::.:....: ::||.||             .|:|:|.:|...:   :|.|.......|.|..
  Rat    77 KLPLFFIVMLNF-AYLCGLS-------------ILSAVSIERCLCV---MRPFWYRCQLPRHTSA 124

  Fly   203 TLATAVSIWLLAIL--------CGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKS--MVL 257
            .:.|  .:|:|:::        ||.  |.|:|:                 .:|    .|:  :::
  Rat   125 VICT--MLWVLSLVLSLSEGKECGF--LPGTNI-----------------SDW----CKTIDLII 164

  Fly   258 LHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICF-- 320
            ..:|:...:.|:|.::..|:.....:|                   ::.||.|..|::|.:.|  
  Rat   165 TSWLIVLFVVLLVSSLALVITIFCGLY-------------------RIPVTRLYVVIVFTVLFFL 210

  Fly   321 ---LPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH-FNR 379
               |||.: :|:...|  |:..|..|......|...:|..|:||||: :||:.|:.|.| |.|
  Rat   211 LFGLPYGI-YLFLLVW--AETFYYVFPCGFLPVTIFLSCINTCANPI-IYFLVGSVRHHRFQR 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 27/112 (24%)
7tm_1 98..364 CDD:278431 62/293 (21%)
Mrgprx2lNP_001002285.1 7tm_1 25..256 CDD:278431 63/295 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.