DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprb5

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001002284.1 Gene:Mrgprb5 / 404644 RGDID:738052 Length:353 Species:Rattus norvegicus


Alignment Length:370 Identity:86/370 - (23%)
Similarity:140/370 - (37%) Gaps:92/370 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYI 83
            :|||:..:..|..|.     |.:...|.:...:       :|..|.::|..|             
  Rat    26 NTSGKFLSVGPATPG-----WSINNTVVKENYY-------TEKLSCIITFNT------------- 65

  Fly    84 VPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYW- 147
            :..|.|.|.|||..||.| ::..|.....|...:.|:.:||.||.|.:.|     .|||::|.. 
  Rat    66 LNFLTATISVVGTAGNAT-VLRLLGFHMHRYAFSVYVFNLAGADFLYLCT-----QTVYSLECVL 124

  Fly   148 ----PYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAV 208
                .|..||.::..|    :...::..:.|:|.:|..::..|: .:|.     :..|.|.||..
  Rat   125 QFDNSYFYFLLTILMF----AYLAALCMIPAISTERCLSVTWPI-WYHC-----QRPRHTSATVC 179

  Fly   209 SI-WLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIA 272
            :: |..::|  |..|:|.....| ..:.....|         .|...:.....:|.:.:|.|...
  Rat   180 ALFWAFSLL--LRLLLGQGCGFL-FGKYDYYFC---------RYCSFITTAFLIVLFVVPFVSSL 232

  Fly   273 VFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGI------CFLPYHVFFLWFY 331
            .....|   :..|..:|        ..|....:|||||.| ..||:      ..||..|.|    
  Rat   233 AMLTKI---ICGSHRIP--------VTRFYVTIAVTVLVF-TFFGLPVGIISLLLPRIVVF---- 281

  Fly   332 FWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH 376
                     ...:::.:||.:..| .|.||||: :||:.|:.|.|
  Rat   282 ---------RGVFYIYKIVTFLYS-VNCCANPI-IYFLIGSIRHH 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 29/104 (28%)
7tm_1 98..364 CDD:278431 63/277 (23%)
Mrgprb5NP_001002284.1 7tm_1 80..306 CDD:278431 64/280 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 333..353
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.