DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mas1l

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001002281.1 Gene:Mas1l / 404641 RGDID:738049 Length:321 Species:Rattus norvegicus


Alignment Length:344 Identity:84/344 - (24%)
Similarity:145/344 - (42%) Gaps:71/344 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 PLLDTGSSENFSELVTTETP---------YVPYGRRPETYIVPILFALIFVVGVLGNGTLI--VV 105
            ||..|...:..::....|||         ...|     |||  .:..:|..:|::|||.||  ::
  Rat     3 PLATTLCPQECTQTTRNETPNETTWSSEHVTKY-----TYI--SISLVICSLGLVGNGLLIWFLI 60

  Fly   106 FLSVRQMRNVPNT-YILSLALADLLVII--TTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGV 167
            |...|:    |.| |||.||.||.:|::  :.:.|.:|.:.     |.|.|.|.:..........
  Rat    61 FCIKRK----PFTIYILHLAFADFMVLLCSSIIQLVNTFHI-----YDSTLVSYAVLFMIFGYNT 116

  Fly   168 SVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGI 232
            .:..|||:|.:|..:::.|: .:|.    ||....:......:|.|::|.       |.|:    
  Rat   117 GLHLLTAISVERCLSVLYPI-WYHC----RRPKHQSTVACTLLWALSVLV-------SGLE---- 165

  Fly   233 NEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIA--VFYVLIALHLMYSASVPGEIQGA 295
            |...|:...|...|....|..|..|. |||:  :||:|.:  :.::.:..:|             
  Rat   166 NFFCILEVKPQFPECRYVYIFSCTLT-FLVF--VPLMVFSNLILFIQVCCNL------------- 214

  Fly   296 VRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSC 360
              :.|...|:.|.::|.|::|.:..:|..|..:..|:   :.....:.|..|..: ..:|..|..
  Rat   215 --KPRQPAKLYVIIMATVILFLVFAMPMKVLLIIGYY---SNSTDASVWKSLPYL-NMLSTINCS 273

  Fly   361 ANPVALYFVSGAFRKHFNR 379
            .||: :|||.|:.|:..:|
  Rat   274 INPI-VYFVVGSLRRKRSR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 31/104 (30%)
7tm_1 98..364 CDD:278431 65/272 (24%)
Mas1lNP_001002281.1 7tm_4 42..>215 CDD:304433 53/215 (25%)
7tm_1 51..279 CDD:278431 66/275 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.