DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprx2

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:XP_017445002.1 Gene:Mrgprx2 / 404640 RGDID:738048 Length:348 Species:Rattus norvegicus


Alignment Length:374 Identity:88/374 - (23%)
Similarity:155/374 - (41%) Gaps:115/374 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LAMVVSQSTQW-----PLLDTGSSE-NFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGN 99
            |..|.|.:..|     .|.|:...| :|.|:|:.              .:.:|..:|.:||::||
  Rat    30 LLRVDSNNPNWGTNITALNDSNDPEMSFCEVVSC--------------AIILLSLIIALVGLVGN 80

  Fly   100 GTLIVVFLSVRQMRNVPNTYILSLALADLLVI-------------ITTVPLASTVYTVEYWPYGS 151
            || :...|..:..||..:.|||:||.||.|.:             :..:|:...::::.....| 
  Rat    81 GT-VFWLLGFQMRRNAFSVYILNLAGADFLFMCFQIVYCSHIMLDMYYIPIKFPLFSIVVLNIG- 143

  Fly   152 FLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPL-----RKFHAHGGGRRATRMTLATAVSIW 211
            :||.:|             .|:|:|.:|..:::.|:     |..|        |...:.|.  :|
  Rat   144 YLCGMS-------------ILSAISIERCLSVMWPIWYRCQRPRH--------TSAVICTL--LW 185

  Fly   212 LLAIL--------CGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPL 268
            :||::        ||.  |..:|                     |..:.::           ..|
  Rat   186 VLALVWSLIEGKECGF--LFDTN---------------------GPGWCET-----------FDL 216

  Fly   269 VVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFW 333
            :..|...|||.:.|..|.::...|...:.::...| :.||::..|::|.:|.|||.::  ||...
  Rat   217 IATAWLIVLIVVLLGSSLALVINIFCGLYRIPVTR-LYVTIVFTVLVFLLCGLPYGIY--WFLLE 278

  Fly   334 PTAQDDYN--AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH-FNR 379
            .|.:.:||  ..:|.:.::..|:   ||||||: :||:.|:.|.| |.|
  Rat   279 WTEKFNYNLPCGFHPVTVLLSCV---NSCANPI-IYFLVGSIRHHRFQR 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 28/117 (24%)
7tm_1 98..364 CDD:278431 66/293 (23%)
Mrgprx2XP_017445002.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.