DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprb8

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_997422.1 Gene:Mrgprb8 / 404240 MGIID:3033134 Length:330 Species:Mus musculus


Alignment Length:303 Identity:61/303 - (20%)
Similarity:122/303 - (40%) Gaps:63/303 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTV--PLASTVYTVEYWP 148
            :|..:|.::|:.|| .:::..|.....||..:.||.:|:.|:.|.:.|.:  .|.:.:....|..
Mouse    34 LLSIIIAIIGLTGN-VIVLQLLGFHMHRNAFSVYIFNLSGANFLFLCTHIVFSLENLIRQFHYID 97

  Fly   149 YGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLL 213
            ....|.|::..:.....|||:  :||:|.:.:.:::.| ..:||    :|....:......:|:.
Mouse    98 IHMALFSVNVTILAYLAGVSM--ITAISVEYWLSVLWP-TWYHA----QRPKHTSTVICTLLWVF 155

  Fly   214 AILCGLPALIGSNLKHLGINEKSIVIC--YPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYV 276
            ::|..|               .:.:||  ..|...|.:.:..:::            :|:.:..:
Mouse   156 SLLLTL---------------WNWIICKVLDYIYNWDMCWKLALI------------IVVWLLVL 193

  Fly   277 LIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVI-----FGICFLPYHVFFLWFYFWPTA 336
            .:.|.....|.:.....|:.:....|..|.:.:.|.||:     .|||          |::|...
Mouse   194 FVVLSRSNQALLFRVFCGSQQTPVTRLLVTIMLTALVVLICGFGIGIC----------FFYWKKE 248

  Fly   337 QDDY---NAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH 376
            ::..   ..|:..:.:    :|..||||||:...||...  ||
Mouse   249 ENSIMPCGYFYETILL----LSGVNSCANPIICLFVGSI--KH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 24/101 (24%)
7tm_1 98..364 CDD:278431 53/277 (19%)
Mrgprb8NP_997422.1 7tm_1 46..276 CDD:278431 54/278 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.