DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprb5

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_997421.1 Gene:Mrgprb5 / 404239 MGIID:3033121 Length:322 Species:Mus musculus


Alignment Length:376 Identity:79/376 - (21%)
Similarity:139/376 - (36%) Gaps:127/376 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VTETLWDLAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLG 98
            :|...|::...|...       :.::|:||.:....|             :..|..:|.:.|:.|
Mouse     3 LTTPAWNINNTVVNG-------SNNTEHFSCVSKFNT-------------LNFLTVIIAMFGLAG 47

  Fly    99 NGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLS------ 157
            | .:::..|:....||..:.|:.:||.||.|.:.|.:             .||..|.|.      
Mouse    48 N-AIVLWLLAFHLPRNAFSVYVCNLACADFLQLCTQI-------------LGSLECFLQLNRRHT 98

  Fly   158 -----EFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAIL- 216
                 .||.....|:.:  :.|:|.:|..:::.|: .:|.    :|....:......:|...:| 
Mouse    99 FFLTVVFMFAYLAGLCM--IAAISVERSLSVMWPI-WYHC----QRPRHTSSIMCALLWAFCLLL 156

  Fly   217 -------CGL----P--------ALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLV 262
                   |||    |        |||.:.|         |::....|.      ..|:.||..::
Mouse   157 NFLLGEGCGLLFSDPKYYFCITCALITTAL---------IILLTVVPS------VSSLALLVKMI 206

  Fly   263 --YYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHV 325
              .:.||   :..|||.|||.|                               |:|....||:.:
Mouse   207 CGSHRIP---VTRFYVTIALTL-------------------------------VVFIFLGLPFGI 237

  Fly   326 FFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH 376
            :..:...:...|..::  :|||.:..: :|..||||||: :||:.|:.|:|
Mouse   238 YSSFLIMFKEFQSIFS--YHVLEVTIF-LSCVNSCANPI-IYFLVGSIRQH 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 25/110 (23%)
7tm_1 98..364 CDD:278431 63/298 (21%)
Mrgprb5NP_997421.1 7tm_1 47..275 CDD:278431 64/301 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 302..322
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.