DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgpra7

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_997418.1 Gene:Mrgpra7 / 404236 MGIID:3033109 Length:305 Species:Mus musculus


Alignment Length:341 Identity:83/341 - (24%)
Similarity:142/341 - (41%) Gaps:79/341 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVPILFALIF-VVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLL----------VIITTVP 136
            ::|.|..:|| :||:.|| .:::..|.....||....|||:|||||.|          :.:..||
Mouse    14 LIPNLMIIIFGLVGLTGN-AIVLWLLGFCLHRNAFLVYILNLALADFLFLLCHFINSAMFLLKVP 77

  Fly   137 LASTVYTVEYWPYGSFL-CSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRAT 200
            :          |.|.|: |..:..|.....|:|:  |:|:|.:|..:::.|: .:|.    ||..
Mouse    78 I----------PNGIFVYCFYTIKMVLYITGLSM--LSAISTERCLSVLCPI-WYHC----RRPE 125

  Fly   201 RMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYA 265
            ..:......||:.::|..:       ||.        ..|..:..:.| ||........|:..|.
Mouse   126 HTSTVMCAVIWIFSVLICI-------LKE--------YFCDFFGTKLG-NYYVCQASNFFMGAYL 174

  Fly   266 IPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWF 330
            :.|.|:.....|..|..::.        ||.:....|  :.||::..:::|.:|.||:.  |.||
Mouse   175 MFLFVVLCLSTLALLARLFC--------GAEKMKFTR--LFVTIMLTILVFLLCGLPWG--FFWF 227

  Fly   331 -YFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGASGRRKKRG 394
             ..|  .:..::...:.|.:.:..::..||||||: :||..|:||                 .|.
Mouse   228 LLIW--IKGGFSVLDYRLYLASIVLTVVNSCANPI-IYFFVGSFR-----------------HRL 272

  Fly   395 QHDTFCMHRDTSLTST 410
            :|.|..|...::|..|
Mouse   273 KHQTLKMVLQSALQDT 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/111 (29%)
7tm_1 98..364 CDD:278431 65/277 (23%)
Mrgpra7NP_997418.1 7tm_1 30..262 CDD:278431 66/280 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.