DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgpra5

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_997417.1 Gene:Mrgpra5 / 404235 MGIID:3033102 Length:287 Species:Mus musculus


Alignment Length:315 Identity:80/315 - (25%)
Similarity:127/315 - (40%) Gaps:85/315 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 ILFALIFVVGVLGNGTLIVVF--LSVRQMRNVPNTYILSLALAD----LLVIITTVPLASTV--- 141
            |:|.|   ||:.||.   :||  |.....||..:.|||:|||||    |..||.::.|..||   
Mouse     3 IIFRL---VGMTGNA---IVFWLLGFSLHRNAFSVYILNLALADFVFLLCHIIDSMLLLLTVFYP 61

  Fly   142 --------YTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRR 198
                    ||:...||   :..||             .|:|:|.:...:::.|: .:..|.....
Mouse    62 NNIFSGYFYTIMTVPY---IAGLS-------------MLSAISTELCLSVLCPI-WYRCHHPEHT 109

  Fly   199 ATRMTLATAVSIWLLAIL-CGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLL---H 259
            :|.|..|    ||:|.:| |.|.....|.|                    .|||......|   .
Mouse   110 STVMCAA----IWVLPLLVCILNRYFCSFL--------------------DINYNNDKQCLASNF 150

  Fly   260 FLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYH 324
            |...|.:.|.|:.....:..|..::..:      |.::..|....:.:|||.|:    :|.||:.
Mouse   151 FTRAYLMFLFVVLCLSSMALLARLFCGT------GQMKLTRLYVTIMLTVLGFL----LCGLPFV 205

  Fly   325 VFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFR---KH 376
            :::...:   ..:|.:..|.....:..:.::..|:||||: :||..|:||   ||
Mouse   206 IYYFLLF---NIKDGFCLFDFRFYMSTHVLTAINNCANPI-IYFFEGSFRHQLKH 256

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 35/116 (30%)
7tm_1 98..364 CDD:278431 67/286 (23%)
Mrgpra5NP_997417.1 7tm_1 12..244 CDD:278431 68/289 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.