DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgpra6

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001295466.1 Gene:Mrgpra6 / 381886 MGIID:3033107 Length:301 Species:Mus musculus


Alignment Length:342 Identity:85/342 - (24%)
Similarity:149/342 - (43%) Gaps:82/342 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IVPILFALIFVVGVLGNGTLIVVF--LSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVE 145
            |..::..::.:||:.||.   :||  |..|..||..:.|||:|||||.|.::..: :|||.:.:.
Mouse    11 ITNLMIVILGLVGLTGNA---IVFWLLLFRLRRNAFSIYILNLALADFLFLLCHI-IASTEHILT 71

  Fly   146 Y-WPYGSFLCSLSEFMKDVSI-GVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAV 208
            : .|...|:..|..|...:.| |:|:  |:|:|.:|..:::.|: .:..|.....:|.|    ..
Mouse    72 FSSPNSIFINCLYTFRVLLYIAGLSM--LSAISIERCLSVMCPI-WYRCHSPEHTSTVM----CA 129

  Fly   209 SIWLLAIL--------CGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFL--VY 263
            .||:|::|        ||.            ::.|       |.:::|      .:.::||  .|
Mouse   130 MIWVLSLLLCILYRYFCGF------------LDTK-------YEDDYG------CLAMNFLTTAY 169

  Fly   264 YAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFL 328
            .....||:.|..:.:...|...|       |.::..|    :.||:...:::|.:|.||  ..|.
Mouse   170 LMFLFVVLCVSSLALLARLFCGA-------GRMKLTR----LYVTITLTLLVFLLCGLP--CGFY 221

  Fly   329 WFYFWPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGASGRRKKR 393
            ||.. ...::.:..|...|.:.:..::..||||||: :||..|:||                 .|
Mouse   222 WFLL-SKIKNVFTVFEFSLYLASVVLTAINSCANPI-IYFFVGSFR-----------------HR 267

  Fly   394 GQHDTFCMHRDTSLTST 410
            .:|.|..|...::|..|
Mouse   268 LKHQTLKMVLQSALQDT 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 34/103 (33%)
7tm_1 98..364 CDD:278431 70/279 (25%)
Mrgpra6NP_001295466.1 7tm_1 26..258 CDD:278431 71/282 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.