DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Gpr151

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_853664.1 Gene:Gpr151 / 307475 RGDID:727873 Length:421 Species:Rattus norvegicus


Alignment Length:337 Identity:78/337 - (23%)
Similarity:147/337 - (43%) Gaps:47/337 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DTGSS---ENFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSV----RQM 112
            |:.||   |:|:.| .....|:|...:....|:|.|.|.:.:||.:||  |.|:.|.:    ::.
  Rat    11 DSDSSNMNESFAHL-HFAGGYLPSDSKGWRTIIPSLLAAVCLVGFVGN--LCVIGLLLHGVWKRK 72

  Fly   113 RNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSG 177
            .::.::.||:|:|||:.:::.:.|:.:|.|....|..|.|:|..|::...:.:.....|...::.
  Rat    73 PSMIHSLILNLSLADISLLLFSAPVRATAYVKGVWDLGWFVCKSSDWFTHMCMAAKSLTFVVVAK 137

  Fly   178 DRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYP 242
            ..:....||.:....|    ..|..:|..|  ||::|.|..||....|..:|....|..:|....
  Rat   138 VCFMYASDPAKPVGTH----NCTIWSLLGA--IWVVASLLPLPEWFFSTTRHHAGVEMCLVDVPA 196

  Fly   243 YPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAV 307
            ...|:...:.|    |:.|:.:.:|| ::|.||...|.:......  .:.|....|:|: :::.|
  Rat   197 VAAEFMSLFGK----LYPLLVFCLPL-LLAGFYFWRAYNQCKIRC--AKTQNLRNQMRS-KQLTV 253

  Fly   308 TVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHV----------LRIVAYCMSFANSCAN 362
            .:|:..|...:.:||..:.:||             .||:          ...::..:.|:.|..|
  Rat   254 MLLSTAVTSALLWLPEWIAWLW-------------VWHLKAGGPMPPQGFIALSQVLMFSISTVN 305

  Fly   363 PVALYFVSGAFR 374
            |:....:|..|:
  Rat   306 PLIFLMMSEEFK 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 25/103 (24%)
7tm_1 98..364 CDD:278431 61/279 (22%)
Gpr151NP_853664.1 7tm_1 56..308 CDD:278431 62/280 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 346..381
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 394..421
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.