DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprx3

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_665730.2 Gene:Mrgprx3 / 252960 RGDID:632282 Length:331 Species:Rattus norvegicus


Alignment Length:341 Identity:93/341 - (27%)
Similarity:152/341 - (44%) Gaps:71/341 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 LDTGSSENFSELVTTETPY---VPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNV 115
            |:|.:|   :..|||..|.   :|......|.|..:|..:..:||::|| .::...|..|..||.
  Rat    13 LNTSAS---TIAVTTTNPMDKTIPGSFNSRTLIPNLLIIISGLVGLIGN-AMVFWLLGFRLARNA 73

  Fly   116 PNTYILSLALADLLVIITTVPLASTVYTVEY-WPYGSFL-CSLSEFMKDVSIGVSVFTLTALSGD 178
            .:.|||:|||||.|.::..: :.||:..::: :|...|| |..:..|.....|:|:  |:|:|.:
  Rat    74 FSVYILNLALADFLFLLCHI-IDSTLLLLKFSYPNIIFLPCFNTVMMVPYIAGLSM--LSAISTE 135

  Fly   179 RYFAIVDPL--RKFHAHGGGRRATRMTLATAVSIWLLAIL--------CGLPALIGSNLKHLGIN 233
            |..::|.|:  |       .||....:.....:||:|::|        ||.            ::
  Rat   136 RCLSVVCPIWYR-------CRRPKHTSTVMCSAIWVLSLLICILNRYFCGF------------LD 181

  Fly   234 EKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQ 298
            .|               |.|....|....:.|..|:.:.|...|.:|.|:...     ..||.|.
  Rat   182 TK---------------YEKDNRCLASNFFTAACLIFLFVVLCLSSLALLVRL-----FCGAGRM 226

  Fly   299 VRARRKVAVTVLAFVVIFGICFLPYHVFFLWF-YFWPTAQDDYNAFWHVLRIVAYCMSFANSCAN 362
            ...|  :..|::..|::|.:|.||:.:.  || ..|  .:.||..|.:.|.:.|..::..|||||
  Rat   227 KLTR--LYATIMLTVLVFLLCGLPFGIH--WFLLIW--IKIDYGKFAYGLYLAALVLTAVNSCAN 285

  Fly   363 PVALYFVSGAFR--KH 376
            |: :||..|:||  ||
  Rat   286 PI-IYFFVGSFRHQKH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 32/103 (31%)
7tm_1 98..364 CDD:278431 72/278 (26%)
Mrgprx3NP_665730.2 7tm_1 57..289 CDD:278431 73/281 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.