DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Tacr1

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_036799.1 Gene:Tacr1 / 24807 RGDID:3811 Length:407 Species:Rattus norvegicus


Alignment Length:442 Identity:113/442 - (25%)
Similarity:196/442 - (44%) Gaps:89/442 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 NLVSMETDLAMNIGLDTSGEAPTALPPMPNVTETLWDLAMVVSQSTQWPLLDTGSSENFSELVTT 68
            |::.|::||..||..:|| |:...:.|...:  .||..|                          
  Rat     3 NVLPMDSDLFPNISTNTS-ESNQFVQPTWQI--VLWAAA-------------------------- 38

  Fly    69 ETPYVPYGRRPETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALAD--LLVI 131
                               :.:|.|..|:||..:|.:.|:.::||.|.|.::::||.|:  :...
  Rat    39 -------------------YTVIVVTSVVGNVVVIWIILAHKRMRTVTNYFLVNLAFAEACMAAF 84

  Fly   132 ITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGG 196
            .|.|.....|:.|  |.||.|.|....|....::..|::::||::.|||.||:.||:.       
  Rat    85 NTVVNFTYAVHNV--WYYGLFYCKFHNFFPIAALFASIYSMTAVAFDRYMAIIHPLQP------- 140

  Fly   197 RRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVIC-YPYPEEWGINYAKSMVLLHF 260
            |.:...|......||:||:|...|....|..:.:    .|.|:| ..:||.....|.|:..:...
  Rat   141 RLSATATKVVIFVIWVLALLLAFPQGYYSTTETM----PSRVVCMIEWPEHPNRTYEKAYHICVT 201

  Fly   261 LVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQGAV-RQVRARRKVAVTVLAFVVIFGICFLPYH 324
            ::.|.:||:||...|.::.:.| :::.:||:..... .||.|:|||...::..|..|.||:||:|
  Rat   202 VLIYFLPLLVIGYAYTVVGITL-WASEIPGDSSDRYHEQVSAKRKVVKMMIVVVCTFAICWLPFH 265

  Fly   325 VFFLWFYFWPTAQDDY-NAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHF-NRYLFCRGAS 387
            ||||..|..|   |.| ..|...:.:.:..::.:::..||:....::..||..| :.:..|...|
  Rat   266 VFFLLPYINP---DLYLKKFIQQVYLASMWLAMSSTMYNPIIYCCLNDRFRLGFKHAFRCCPFIS 327

  Fly   388 GRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTL 439
            .     |.::        .|...:::..|::.|.|:.:    || ||||:|:
  Rat   328 A-----GDYE--------GLEMKSTRYLQTQSSVYKVS----RL-ETTISTV 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 33/101 (33%)
7tm_1 98..364 CDD:278431 79/270 (29%)
Tacr1NP_036799.1 7tm_1 54..305 CDD:278431 78/267 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 362..407 113/442 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4219
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.