DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprb1

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_991379.3 Gene:Mrgprb1 / 233231 MGIID:3033115 Length:350 Species:Mus musculus


Alignment Length:378 Identity:93/378 - (24%)
Similarity:157/378 - (41%) Gaps:97/378 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EAPTALPPMPNVTETL--WDLAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYIVP 85
            |..|.:.|:..:...:  |.:.:...:.:.    |.|.|  |.|:|:          |..|:   
Mouse     2 EQRTEIAPLLKMDLVIQDWTINITALKESN----DNGIS--FCEVVS----------RTMTF--- 47

  Fly    86 ILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLV----IITTVPLASTVYTVEY 146
             |..:|.:||::||.| ::.||..:..||..:.|||:||.||.:.    |:....:...:|.:..
Mouse    48 -LSLIIALVGLVGNAT-VLWFLGFQMSRNAFSVYILNLAGADFVFMCFQIVHCFYIILDIYFIPT 110

  Fly   147 WPYGSFLCSLS-EFMKDVSIGVSVFTLTALSGDRYFAIVDPL-----RKFHAHGGGRRATRMTLA 205
            ..:.|:...|: .::..:||      ||.:|.:|:.:::.|:     |..|        |...:.
Mouse   111 NFFSSYTMVLNIAYLSGLSI------LTVISTERFLSVMWPIWYRCQRPRH--------TSAVIC 161

  Fly   206 TAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIP--- 267
            |.  :|:|:::..|  |.|                    :|.|           ||.|.:.|   
Mouse   162 TV--LWVLSLVLSL--LEG--------------------KECG-----------FLYYTSGPGLC 191

  Fly   268 ----LVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFL 328
                |:..|...||..:.|..|.::...|...:.:|...| :.||::..|::|.|..|||.::  
Mouse   192 KTFDLITTAWLIVLFVVLLGSSLALVLTIFCGLHKVPVTR-LYVTIVFTVLVFLIFGLPYGIY-- 253

  Fly   329 WFYF-WPTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKH-FNR 379
            ||.. |.....|.....  .|.|...:|..||||||: :||:.|:.|.| |.|
Mouse   254 WFLLEWIREFHDNKPCG--FRNVTIFLSCINSCANPI-IYFLVGSIRHHRFQR 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 28/109 (26%)
7tm_1 98..364 CDD:278431 69/283 (24%)
Mrgprb1NP_991379.3 7tm_4 50..>183 CDD:304433 40/182 (22%)
7tm_1 59..290 CDD:278431 70/286 (24%)
Fijivirus_P9-2 <186..>275 CDD:284300 23/93 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.