DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgpra3

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_694707.2 Gene:Mrgpra3 / 233222 MGIID:2684085 Length:329 Species:Mus musculus


Alignment Length:347 Identity:92/347 - (26%)
Similarity:152/347 - (43%) Gaps:67/347 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 LAMVVSQSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYIVPILFALIF-VVGVLGNGTLIV 104
            ||...|.||..|......:|.....:..||            ::|.|..:|| :||:.||.   :
Mouse    11 LARNTSASTMTPTTTNSMNETIPGSIDIET------------LIPDLMIIIFGLVGLTGNA---I 60

  Fly   105 VF--LSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEY-WPYGSFLCSLSEFMKDVSI- 165
            ||  |..|..|.....|||:|||||.|.::..: :.|||..::: .|.|.|........:.:.| 
Mouse    61 VFWLLGFRMHRTAFLVYILNLALADFLFLLCHI-INSTVDLLKFTLPKGIFAFCFHTIKRVLYIT 124

  Fly   166 GVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAIL-CGLPALIGSNLKH 229
            |:|:  |:|:|.:|..:::.|: .:|.    ||....:......||:|::| |.|.......|.:
Mouse   125 GLSM--LSAISTERCLSVLCPI-WYHC----RRPEHTSTVMCAVIWVLSLLICILDGYFCGYLDN 182

  Fly   230 LGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVPGEIQG 294
            ...|       |...:.|.|          |:..|.:.|.|:.....|..|..::..:       
Mouse   183 HYFN-------YSVCQAWDI----------FIGAYLMFLFVVLCLSTLALLARLFCGA------- 223

  Fly   295 AVRQVRARRKVAVTVLAFVVIFGICFLPYHV-FFLWFYFWP-TAQDDYNAFWHVLRIVAYCMSFA 357
              |.::..| :.||::..|::|.:|.||:.: :||.|:..| ....||:..        ..::..
Mouse   224 --RNMKFTR-LFVTIMLTVLVFLLCGLPWGITWFLLFWIAPGVFVLDYSPL--------LVLTAI 277

  Fly   358 NSCANPVALYFVSGAFRKHFNR 379
            ||||||: :||..|:||:..|:
Mouse   278 NSCANPI-IYFFVGSFRQRLNK 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 34/104 (33%)
7tm_1 98..364 CDD:278431 70/272 (26%)
Mrgpra3NP_694707.2 7tm_1 57..286 CDD:278431 71/275 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.