DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgpra1

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_694735.2 Gene:Mrgpra1 / 233221 MGIID:3033095 Length:331 Species:Mus musculus


Alignment Length:350 Identity:92/350 - (26%)
Similarity:155/350 - (44%) Gaps:80/350 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 DTGSSENFSELVTTETPYVPYGRRPE----------TYIVPILFALIF-VVGVLGNGTLIVVF-- 106
            ::.:...|..|.|:.:|..|....|.          |.::|.|..:|| :||:.|||   :||  
Mouse     3 ESSTCAGFLALNTSASPTAPTTTNPMDNTIPGGINITILIPNLMIIIFGLVGLTGNG---IVFWL 64

  Fly   107 LSVRQMRNVPNTYILSLALADLLV----IITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGV 167
            |.....||..:.|||:|||||...    ||.::.|...|    ::|....||..:..|.....|:
Mouse    65 LGFCLHRNAFSVYILNLALADFFFLLGHIIDSILLLLNV----FYPITFLLCFYTIMMVLYIAGL 125

  Fly   168 SVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAIL--------CGLPALIG 224
            |:  |:|:|.:|..:::.|: .:|.|   |.....|:..|| ||:|::|        ||.     
Mouse   126 SM--LSAISTERCLSVLCPI-WYHCH---RPEHTSTVMCAV-IWVLSLLICILNSYFCGF----- 178

  Fly   225 SNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSASVP 289
                   :|.:       |..|.|     .:.|..|...|.:.|.|:.....|..:..::..:  
Mouse   179 -------LNTQ-------YKNENG-----CLALSFFTAAYLMFLFVVLCLSSLALVARLFCGT-- 222

  Fly   290 GEIQGAVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCM 354
                |.::..|    :.||::..:::|.:|.||:.:.  ||..: ..:||::.|.....:.:..:
Mouse   223 ----GQIKLTR----LYVTIILSILVFLLCGLPFGIH--WFLLF-KIKDDFHVFDLGFYLASVVL 276

  Fly   355 SFANSCANPVALYFVSGAFR---KH 376
            :..||||||: :||..|:||   ||
Mouse   277 TAINSCANPI-IYFFVGSFRHRLKH 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 35/106 (33%)
7tm_1 98..364 CDD:278431 71/279 (25%)
Mrgpra1NP_694735.2 7tm_1 57..288 CDD:278431 72/282 (26%)
UPF0182 194..>295 CDD:304904 27/114 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.