DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Mrgprf

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_663354.1 Gene:Mrgprf / 211577 MGIID:2384823 Length:343 Species:Mus musculus


Alignment Length:309 Identity:75/309 - (24%)
Similarity:130/309 - (42%) Gaps:71/309 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    79 PETYIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYT 143
            |...:...:|.|:.:.|::||| |::.|......|...:.|.|.||.||.:.:.:...:|     
Mouse    42 PPPAVTNYIFLLLCLCGLVGNG-LVLWFFGFSIKRTPFSIYFLHLASADGMYLFSKAVIA----- 100

  Fly   144 VEYWPYGSFLCSLSEFMKDVS--IGVSVF-----TLTALSGDRYFAIVDPLRKFHAHGGGRRATR 201
              ....|:||.|..::::.||  :|:..|     .|.|:|.:|..:::.|...:.     ||..|
Mouse   101 --LLNMGTFLGSFPDYIRRVSRIVGLCTFFTGVSLLPAISIERCVSVIFPTWYWR-----RRPKR 158

  Fly   202 MTLATAVSIWLLAILCGLPALIGSNLKHLGINEKSIVICYPYPEEWGINYAKSMVLLHFLVYYAI 266
            ::......:|:|:.|  :.::.......|| :|....:|.......||       ||.||.   .
Mouse   159 LSAGVCALLWMLSFL--VTSIHNYFCMFLG-HEAPGTVCRNMDIALGI-------LLFFLF---C 210

  Fly   267 PLVVIAVFYVLIALHLMYSASVPGEIQGAVRQVRARR-----KVAVTVLAFVVIFGICFLPYHVF 326
            ||:|:..  :.:.||:               :.||||     |:...|||.|.:|.:..:  ::.
Mouse   211 PLMVLPC--LALILHV---------------ECRARRRQRSAKLNHVVLAIVSVFLVSSI--YLG 256

  Fly   327 FLWFYFW----PTAQDDYNAFWHVLRIVAYCMSFANSCANPVALYFVSG 371
            ..||.||    |....:|        :...|:.. ||.|.|: :||::|
Mouse   257 IDWFLFWVFQIPAPFPEY--------VTDLCICI-NSSAKPI-VYFLAG 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 29/106 (27%)
7tm_1 98..364 CDD:278431 67/281 (24%)
MrgprfNP_663354.1 7tm_1 62..291 CDD:278431 67/283 (24%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 318..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.