DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and EDNRA

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001948.1 Gene:EDNRA / 1909 HGNCID:3179 Length:427 Species:Homo sapiens


Alignment Length:450 Identity:123/450 - (27%)
Similarity:195/450 - (43%) Gaps:117/450 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLAMVVS--QSTQWPLLDTGSSENFSELVTTETPYVPYGRRPETYIVPILFALIFVVGVLGNGTL 102
            :|:.:|:  |.|...|...||..|:....|..|...       .||..::...||:||::||.||
Human    44 ELSFLVTTHQPTNLVLPSNGSMHNYCPQQTKITSAF-------KYINTVISCTIFIVGMVGNATL 101

  Fly   103 IVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWP-----YGSFLCSLSEFMKD 162
            :.:....:.|||.||..|.||||.||:.::..:|:.........||     :|.|||.|..|::.
Human   102 LRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHNDFGVFLCKLFPFLQK 166

  Fly   163 VSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATA---VSIWLLAILCGLPALIG 224
            .|:|::|..|.|||.|||.|:....|   ..|.|     :.|.||   ||||:|:.:..:|..||
Human   167 SSVGITVLNLCALSVDRYRAVASWSR---VQGIG-----IPLVTAIEIVSIWILSFILAIPEAIG 223

  Fly   225 SNL---KHLGINEKSIVI--------CYPYPEEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLI 278
            ..:   ::.|...|:.::        .|...::|.:          |..|:.:|||..|:||.|:
Human   224 FVMVPFEYRGEQHKTCMLNATSKFMEFYQDVKDWWL----------FGFYFCMPLVCTAIFYTLM 278

  Fly   279 ALHLMYSASVPGEIQGAVRQ-VRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYN- 341
            ...::...:  |.::.|:.: ::.||:||.||...||||.:|:.|.|:..:      ..:..|| 
Human   279 TCEMLNRRN--GSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRI------LKKTVYNE 335

  Fly   342 ---------AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGASGRRKKRGQHD 397
                     :|..::..:...::..|||.||:||||||..|:..|...|.|              
Human   336 MDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCC-------------- 386

  Fly   398 TFCMHRDTSLTSTASKRFQSRHSCYQSTIRSCRLQETTITTLPNGG--------NQNGAN 449
              |                    ||||        ::.:|::|..|        :||..|
Human   387 --C--------------------CYQS--------KSLMTSVPMNGTSIQWKNHDQNNHN 416

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 40/104 (38%)
7tm_1 98..364 CDD:278431 85/295 (29%)
EDNRANP_001948.1 7tmA_ET-AR 81..380 CDD:320641 99/324 (31%)
TM helix 1 82..108 CDD:320641 9/25 (36%)
TM helix 2 115..141 CDD:320641 10/25 (40%)
TM helix 3 158..188 CDD:320641 14/29 (48%)
TM helix 4 200..220 CDD:320641 8/19 (42%)
TM helix 5 252..277 CDD:320641 9/34 (26%)
TM helix 6 299..329 CDD:320641 13/35 (37%)
TM helix 7 348..373 CDD:320641 9/24 (38%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 406..427 2/10 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.