DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Nmbr

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_032729.1 Gene:Nmbr / 18101 MGIID:1100525 Length:390 Species:Mus musculus


Alignment Length:415 Identity:147/415 - (35%)
Similarity:219/415 - (52%) Gaps:58/415 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NFSELV--TTETPYVP--YGRRPETYI---VPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNT 118
            |.||||  ..|..::|  .|...|..|   :|.|:.:|..||:|||..|:.:||:...||||||.
Mouse    16 NESELVPEVWEKDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLGNIMLVKIFLTNSAMRNVPNI 80

  Fly   119 YILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAI 183
            :|.:||..|||:::|.||:.::.|..:.|.:|...|.|...::..|:|||||||||||.|||.||
Mouse    81 FISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIPAIQLTSVGVSVFTLTALSADRYRAI 145

  Fly   184 VDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLG-INEKSIVICYPYPEEW 247
            |:|: .....|    ....|...||.||::::|..:|..:.|.:..:| ::..|...|.|||:..
Mouse   146 VNPM-DMQTSG----VLLWTSLKAVGIWVVSVLLAVPEAVFSEVARIGSLDNSSFTACIPYPQTD 205

  Fly   248 GINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSA-SVPGEI-QGAVRQVRARRKVAVTVL 310
            .: :.|...:|.||||:.||||:|:::|..||..|:.|| ::|||. :...:|:..|:::|..||
Mouse   206 EL-HPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLIKSAHNLPGEYNEHTKKQMETRKRLAKIVL 269

  Fly   311 AFVVIFGICFLPYHVFFLWFYFWPTAQDDYN----AFWH-VLRIVAYCMSFANSCANPVALYFVS 370
            .||..|..|:.|.||.:|:..|      :|.    :..| ::.:||..:||:|||.||.|||.:|
Mouse   270 VFVGCFVFCWFPNHVLYLYRSF------NYKEIDPSLGHMIVTLVARVLSFSNSCVNPFALYLLS 328

  Fly   371 GAFRKHFNRYLFCRGASGRRKKRGQHDTFCMHRDTSLTSTASKRFQSRHSCY---QSTIRSCRLQ 432
            .:||||||..|.|    ||                       |.:..|.:.|   .|.:|...|:
Mouse   329 ESFRKHFNSQLCC----GR-----------------------KSYPERSTSYLLSSSAVRMTSLK 366

  Fly   433 ETTITTLPNGGNQNGANISAVELAL 457
            ..|...:.|....|| :.:..|:||
Mouse   367 SNTKNVVTNSVLLNG-HSTKQEIAL 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 48/99 (48%)
7tm_1 98..364 CDD:278431 103/273 (38%)
NmbrNP_032729.1 7tm_1 60..322 CDD:278431 103/273 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3534
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H20560
Inparanoid 1 1.050 225 1.000 Inparanoid score I3485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001846
OrthoInspector 1 1.000 - - mtm8893
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4897
SonicParanoid 1 1.000 - - X1046
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.090

Return to query results.
Submit another query.