DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Ednrb

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_001129533.1 Gene:Ednrb / 13618 MGIID:102720 Length:442 Species:Mus musculus


Alignment Length:344 Identity:107/344 - (31%)
Similarity:167/344 - (48%) Gaps:48/344 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 YIVPILFALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEY 146
            ||..|:..|:||:|::||.||:.:....:.|||.||..|.||||.|||.||..:|:.:.....|.
Mouse   102 YINTIVSCLVFVLGIIGNSTLLRIIYKNKCMRNGPNILIASLALGDLLHIIIDIPINTYKLLAED 166

  Fly   147 WPYGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIW 211
            ||:|:.:|.|..|::..|:|::|.:|.|||.|||.|:....|   ..|.|  ..:.|....|.||
Mouse   167 WPFGAEMCKLVPFIQKASVGITVLSLCALSIDRYRAVASWSR---IKGIG--VPKWTAVEIVLIW 226

  Fly   212 LLAILCGLPALIGSNLKHLGINEKSIVIC-------------YPYPEEWGINYAKSMVLLHFLVY 263
            :::::..:|..||.::.......|.:.:|             |...::|.:          |..|
Mouse   227 VVSVVLAVPEAIGFDMITSDYKGKPLRVCMLNPFQKTAFMQFYKTAKDWWL----------FSFY 281

  Fly   264 YAIPLVVIAVFYVLIALHLMYSASVPGEIQGAVR-QVRARRKVAVTVLAFVVIFGICFLPYH--- 324
            :.:||.:.||||.|:...::...|   .:|.|:. .::.||:||.||...|::|.:|:||.|   
Mouse   282 FCLPLAITAVFYTLMTCEMLRKKS---GMQIALNDHLKQRREVAKTVFCLVLVFALCWLPLHLSR 343

  Fly   325 VFFLWFYFWPTAQDDYN-------AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLF 382
            :..|..|      |..|       :|..||..:...|:..|||.||:|||.||..|:..|...|.
Mouse   344 ILKLTLY------DQSNPHRCELLSFLLVLDYIGINMASLNSCINPIALYLVSKRFKNCFKSCLC 402

  Fly   383 CRGASGRRKKRGQHDTFCM 401
            |...:...|:..:....|:
Mouse   403 CWCQTFEEKQSLEEKQSCL 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 42/99 (42%)
7tm_1 98..364 CDD:278431 88/289 (30%)
EdnrbNP_001129533.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 50..84
7tmA_ET-BR 102..397 CDD:320642 102/318 (32%)
TM helix 1 103..129 CDD:320642 10/25 (40%)
TM helix 2 136..162 CDD:320642 13/25 (52%)
TM helix 3 174..204 CDD:320642 14/29 (48%)
TM helix 4 216..236 CDD:320642 4/19 (21%)
TM helix 5 270..295 CDD:320642 9/34 (26%)
TM helix 6 316..346 CDD:320642 12/29 (41%)
TM helix 7 365..390 CDD:320642 11/24 (46%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.