DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Ednra

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_034462.1 Gene:Ednra / 13617 MGIID:105923 Length:427 Species:Mus musculus


Alignment Length:438 Identity:121/438 - (27%)
Similarity:198/438 - (45%) Gaps:97/438 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    40 DLAMVVSQSTQWPLLDTGSSENFSELVTTETP-------------YVPYGRRPET---YIVPILF 88
            :|:..:...|.:|    |:..||  |.||..|             |.|...:..|   ||..::.
Mouse    29 NLSSHMEDFTPFP----GTEINF--LGTTHRPPNLALPSNGSMHGYCPQQTKITTAFKYINTVIS 87

  Fly    89 ALIFVVGVLGNGTLIVVFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWP----- 148
            ..||:||::||.||:.:....:.|||.||..|.||||.||:.::..:|:.........||     
Mouse    88 CTIFIVGMVGNATLLRIIYQNKCMRNGPNALIASLALGDLIYVVIDLPINVFKLLAGRWPFDHND 152

  Fly   149 YGSFLCSLSEFMKDVSIGVSVFTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATA---VSI 210
            :|.|||.|..|::..|:|::|..|.|||.|||.|:....|   ..|.|     :.|.||   |||
Mouse   153 FGVFLCKLFPFLQKSSVGITVLNLCALSVDRYRAVASWSR---VQGIG-----IPLITAIEIVSI 209

  Fly   211 WLLAILCGLPALIGSNL---KHLGINEKSIVI--------CYPYPEEWGINYAKSMVLLHFLVYY 264
            |:|:.:..:|..||..:   ::.|...::.::        .|...::|.:          |..|:
Mouse   210 WILSFILAIPEAIGFVMVPFEYKGELHRTCMLNATSKFMEFYQDVKDWWL----------FGFYF 264

  Fly   265 AIPLVVIAVFYVLIALHLMYSASVPGEIQGAVRQ-VRARRKVAVTVLAFVVIFGICFLPYHVFFL 328
            .:|||..|:||.|:...::...:  |.::.|:.: ::.||:||.||...||||.:|:.|.|:..:
Mouse   265 CMPLVCTAIFYTLMTCEMLNRRN--GSLRIALSEHLKQRREVAKTVFCLVVIFALCWFPLHLSRI 327

  Fly   329 WFYFWPTAQDDYN-------AFWHVLRIVAYCMSFANSCANPVALYFVSGAFRKHFNRYLFCRGA 386
               ...|..|:.:       :|..::..:...::..|||.||:||||||..|:..|...|.|   
Mouse   328 ---LKKTVYDEMDKNRCELLSFLLLMDYIGINLATMNSCINPIALYFVSKKFKNCFQSCLCC--- 386

  Fly   387 SGRRKKRGQHDTFCMHRDTSLTSTA---------SKRFQSRHSCYQST 425
                         |.|:..||.::.         ..:.|:.|:..:|:
Mouse   387 -------------CCHQSKSLMTSVPMNGTSIQWKNQEQNNHNTERSS 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 40/104 (38%)
7tm_1 98..364 CDD:278431 84/292 (29%)
EdnraNP_034462.1 7tm_1 97..367 CDD:278431 84/292 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 408..427 3/14 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.