DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CCHa1-R and Brs3

DIOPT Version :9

Sequence 1:NP_611241.2 Gene:CCHa1-R / 37004 FlyBaseID:FBgn0050106 Length:499 Species:Drosophila melanogaster
Sequence 2:NP_033896.2 Gene:Brs3 / 12209 MGIID:1100501 Length:399 Species:Mus musculus


Alignment Length:349 Identity:129/349 - (36%)
Similarity:196/349 - (56%) Gaps:18/349 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 SQSTQWPLLD-TGSSENFSELVTTETPYVPYGRRPETYI-----VPILFALIFVVGVLGNGTLIV 104
            |||....|:. |..:|..|.:|:.:|.:..:.......|     :.|.:|.|..||:|||..||.
Mouse     6 SQSPNQTLISITNDTETSSSVVSNDTTHKGWTGDNSPGIEALCAIYITYAGIISVGILGNAILIK 70

  Fly   105 VFLSVRQMRNVPNTYILSLALADLLVIITTVPLASTVYTVEYWPYGSFLCSLSEFMKDVSIGVSV 169
            ||...:.|:.|||.:|.|||..|||:::|.||:.:|.|..|.|.:|...|.:..|::..|:||||
Mouse    71 VFFKTKSMQTVPNIFITSLAFGDLLLLLTCVPVDATHYLAEGWLFGKVGCKVLSFIRLTSVGVSV 135

  Fly   170 FTLTALSGDRYFAIVDPLRKFHAHGGGRRATRMTLATAVSIWLLAILCGLPALIGSNLKHLGINE 234
            ||||.||.|||.|:|.||.:...:     |...|.|.|..||:::::..||..|.||:.......
Mouse   136 FTLTILSADRYKAVVKPLERQPPN-----AILKTCAKAGGIWIVSMIFALPEAIFSNVYTFQDPN 195

  Fly   235 KSIVI--CYPYP-EEWGINYAKSMVLLHFLVYYAIPLVVIAVFYVLIALHLMYSA-SVPGEIQG- 294
            :::..  |..|| .|..:....|  ||.|||:|.|||.:|:|:|.|||..|..|. ::|.|.|. 
Mouse   196 RNVTFESCNSYPISERLLQEIHS--LLCFLVFYIIPLSIISVYYSLIARTLYKSTLNIPTEEQSH 258

  Fly   295 AVRQVRARRKVAVTVLAFVVIFGICFLPYHVFFLWFYFWPTAQDDYNAFWHVLRIVAYCMSFANS 359
            |.:|:.:|:::|.|||..|.:|.:|:||.|:.:|:..|...:..:::....|:.|.:..::|:||
Mouse   259 ARKQIESRKRIAKTVLVLVALFALCWLPNHLLYLYHSFTYESYANHSDVPFVIIIFSRVLAFSNS 323

  Fly   360 CANPVALYFVSGAFRKHFNRYLFC 383
            |.||.|||::|..|::||...|.|
Mouse   324 CVNPFALYWLSKTFQQHFKAQLCC 347

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CCHa1-RNP_611241.2 7tm_4 88..>188 CDD:304433 49/99 (49%)
7tm_1 98..364 CDD:278431 103/270 (38%)
Brs3NP_033896.2 7tm_1 64..328 CDD:278431 103/270 (38%)
7tm_4 <137..347 CDD:304433 79/216 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 178 1.000 Domainoid score I3534
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 225 1.000 Inparanoid score I3485
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1153238at2759
OrthoFinder 1 1.000 - - FOG0001846
OrthoInspector 1 1.000 - - mtm8893
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45695
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R4897
SonicParanoid 1 1.000 - - X1046
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1010.100

Return to query results.
Submit another query.